SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03009T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_03009T0
Domain Number 1 Region: 254-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000256
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  PTSG_03009T0
Domain Number - Region: 193-259
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00504
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number - Region: 909-945
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0357
Family Cna protein B-type domain 0.028
Further Details:      
 
Domain Number - Region: 347-388
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0692
Family Fibronectin type III 0.0064
Further Details:      
 
Domain Number - Region: 788-835
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0785
Family Pre-dockerin domain 0.047
Further Details:      
 
Domain Number - Region: 1112-1169
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 0.0804
Family Aconitase iron-sulfur domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_03009T0
Sequence length 2364
Comment | PTSG_03009 | Salpingoeca rosetta predicted protein (2365 aa)
Sequence
MTVPQPAAIALVLLAMLVAPPPVHAVTYSNNFDQPLSYNCPSGQGISQIYSYHDNGKEDR
RWGFECTSYGAGASSVTTTTNYLNNFDQPVDYLCNTNQFLDGVYSYHDNGPEDRRWKFRC
RGVIGAKLTGCAKTSYQNNYDQPISFTVRDGYAIGGLASVHDNGPEDRVWQVYQCQIDCD
SDNGYVSSGTFGCEKVSCGALSLTNGETSGDCSGNFGDKCTYKSCNAGYELSSSGSFGAR
ECRVIGGKGSWSGSPRTCDDINECTSGTHDCVSPAKCVNDAGTFHCDCPYGALDATGKKC
DVGGPSATITASALEISMAISGATAFPKYELSIGQWAFDLSQTTILPDYPVTLNGPLTSR
SFTNLNPGRRFQIMITPIDNDGNKVPASQYVGGDSSGDISTYCGCTTADTTGAPTELSLT
QSYGKVLFAWTDQSYCESGFSFNRNGVGLSANYDVTSEKECGGEHKPTNVYDDLALQKDD
VYSSIDDNMFYALPEGSIFVPVTLPAGTRYAYPAELIEGDHFASPSVSTQAAVTTHTTTT
AAEAVTTSTTDGNLDVTTSAHSWTTPVVGGTTLGENYFTPPANTVPTTTTTPPGDSDQEA
ATTTTPANALETEYLTGTSTVVFTARECADLCIERAEWCIAITVQERTDGQLVCHQLRLI
RYTGMSQDDVSVQTLRRVDITGTGVEGSYIFQGSKSDCETACSKTEDCVMTILDKQFCAT
ANTRVATMVNPNTYDQDLVPEYYRRYVGTAPGQQLKYCVLATNPIDYSASGYSSKETCEY
LTVQWEAAVRGQVTIDSEEIHLPVDGVTIEYEIGDVKGTRTTDADGFFEIHVETNKITRS
HATVTLRFFKSTGSIQHTFSCGGMPCTETKLIVEHLRFDHQVDIRDTTSMPFSGRVTIKG
TEHPGFPAGCPLKDVEVCLYDRNQGDYVVGCAITDAKGYYTAQAVLGASVGVRLSFGNSS
HTFERAAYTDNTPNAPSGFFIRQDPVTSRDVKTPYYDITEEKLWERINFQDITTNEATVD
VAGGKCNLVLGRTTLEFRYDSCPTWVRTEHTTQRISKWTLPAHRIAVRFQRLVRDGNVRE
EITRYFSAAIDDSRSLYVELQDPKNTNQTLKTARFEYHPPPQLGIRFTGEVKNNCTYSDH
TPYHVIKQNTQSQVTITVTEYYGAGVGTCDIVPGEVVITNHLGESPDTVAALNGSSSLTN
TQLNLLKECYYPCTRHVIMDTTSTAKGDVLSNSRVELVVLTGSPELNAQVLDSEHPYTKL
FSATMHNKPYDPVTDVVRVVVTGDVALKPLASIPFPRYKPLLVVQDPPGGLSSAAYSNVY
ANYKMESDTYDEYGGFFLGLEVTPFKVDATLDLCVGLGAANCINLVTAKSSPVTIMAETT
NLFGTKDADDNEETGKVWSFEIDVATSEAAVLAGERSDMFLVPALNVVFLDTYTISFDKA
TCGASKSKRTKWSLASKENREVMSWLSAYEIETKELPDLRARLANTANNDTAEQKAELRN
AITAWENNLKRNKDVRAMAGAGSLKSVQSLWATDDFDHADADNIDGGMGKGIALAPHKLI
EQAKQLSGATATEQQQTSLKAINTIKFSGGGSTYTFAYDTSLDKSATSGTMREHEFKGGA
AISHEFTGSGIGTEFKITPLGIGKWEASSEDQEGYQLEEHVEFTLGDDDPFDVFDVEVFK
HPDFNTLVFHTASGQSSCPHEENTLELEKPGISVLEAPSAPVLPDEPAVFRLLLSNDGDY
TTYMQLYAVNGQNQDGLEISVDGRSLVAPIDYVGFAPGATQITVIMRRGPKVFKYDPVDL
WFSSLCEQERLADTGYLSDEAVAQKRVTLQVEFLQPCSPVQLVGAIGEAGTFVVNAATDQ
ATSGTTDETNLHPGELRLVAFNPDHSKRTWQEDDRLKGVIVEYKRHIDGDTAWMPARDKS
GNTLEISGQANEYGYVTVWWDVSGLLEGEHDLRIRARCEKSINQVPDGIDEQYSQVAFGV
VDRTPPRVLGTPEPADGEYKPGDMISFEFDEAIQCSKPFQFEVRMEVDGLDRVFDNSNMV
IVCEGRKIAMSLRRGFTWDDVNAKSAQLALGMVTDKYGNAVQQNIMLFFTFATLSLHDAT
AHVSGLKLKTAFDRAFYNTSSPLYKATANKVRSDIAHALGINPSRVMVVGLSPVDSIEFD
RGTHVDINFLPASANTSFPAGAPALNARRRETTAIEQTPSALATMLEMVVARPDAAGLEE
SNVLLQLTADSRVDTELTAAAMYNTTTTPFSVTFEGSTSSDTPHEIKVPVYFTLALLFVI
LGVQVVTCLRVGGGTGRRSYKMPGSFRVSPEHRPMSHMSGLSAATTLEERGTHVHETAVD
VDPHADHPGSSFEENPRSLGTTNA
Download sequence
Identical sequences PTSG_03009T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]