SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03046T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_03046T0
Domain Number 1 Region: 825-968
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000816
Family Growth factor receptor domain 0.017
Further Details:      
 
Weak hits

Sequence:  PTSG_03046T0
Domain Number - Region: 1061-1117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000352
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 1080-1187
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00104
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 1016-1070
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00368
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 798-832
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00703
Family Merozoite surface protein 1 (MSP-1) 0.046
Further Details:      
 
Domain Number - Region: 671-714
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0201
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 978-1008
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0276
Family EGF-type module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_03046T0
Sequence length 1391
Comment | PTSG_03046 | Salpingoeca rosetta hypothetical protein (1392 aa)
Sequence
MRGGVVRVALTLVLLLVVLSMPSSGQANVQQTPTQQGPSRVPDLRKYNQPTKQGRRVYDH
FVVKGAGGQHTELRYDMTYAEDVVPLSDFVDEHAAFQVTTVLCTSESIVLGVSDIEAARN
FIAPERVLFPGESFKCSGPSNEHTAAYVEEVAVSEGKLVLSVEWEHFMTAFDEIDIELHH
RPEGHANSSMAQGSGPRAPRMRRETVQGCTCTDDCGVDVDIGLFDQDISSWCHTADNCAD
GRDYCTAELSANADVVSWNYAGGGNAEQASYELYSEGGVTISCEDCYATLNAGVTFRFHA
TGGLSVDLMELTATATAAAQATLQAQFQAQASFEFETPPLLGENGVPGPTFIIPVITIPL
QTSINFRAMLEMQATATVTVSAGISYERSITGGVAYTDGDFSGIREVGGSGLETHGPTFD
AGVHATAVLRLIPQIRLFITEALPLSLTVSLQPYVGAEGDINLQKLVAEAFWGLDLGLAT
EAIEFGPLTIVDAWEDAFALIERKTIGTFRREFNRRRDYAFEDTPRVLIEECNFECPSNS
TCISENGVAACYCDQGFEAHRDIQEADECRLALTRSPLNCVRTATEESELCAQVDCHLIP
NAECRRGMCFCRDGYVADIRNRQPVCTRADGLSPEDPCANVTCGAHSTCTAGQCVCNDGF
HLEEYEDGFDCVPTDPCNGVVCGLSAFCIRGMCHCAVGFILSDDGFNCAPHLPECGSMTD
EIMDRSTCYPGATCQEDSQFPDRQHCVCDDDRELRFYEDGTVACEAPNLCSQFPCPPGHV
CKLQPVTRQPACVRVAEPCKVGNGGCGVNAHCVRDEDEAGWSCECNQGHYGNPFRECVLR
NPCQVDASGGCSIHADCSVDENNERMCMCKEGYTGDGYTCKFSACERDDAPVCHEKGMCV
AANQRGQAKCVCKSGYFGNGTHCFSADPCAENGPCDPSSSICIIDNEQPMCACAPGHVLS
ENGTACVEAPACNAAAFSLKCSTNADCVVVNETASCRCKAGYRDVGRESDPEGYRCQRVD
PCVEHSDDLCPGDYMVCANNKPGRYRCRCQPGFELTNDYECAEINPCESGHRSGCDKDAV
CNHTGPGTHTCTCLDGFTGDGFTCTPLNPCEDGASPCEAETEVCQYLGPNRHRCVCQDGY
ARDEETGMCAPRNMCAVLQGGCPANSYCHMDAVNAFSCVCEFGFYPTGTSLFQTGIRALS
SCQSARVDIVTTRRGLTATEASALVRDALQQFPEARGVVLANVTAEETDAIRGLFRTTIV
VEHMDTQQGEPVALRPMLVADALNATFIAEDGTRAAVDPQEMRTSPVFQGAFVAYFSPYS
AQSIDAVRFEAATQSSANGLSGGAIAGAVIGSVFAVAIVAAVTIAVVRRGGLRKVDVFSH
GPRTTTTSSDV
Download sequence
Identical sequences PTSG_03046T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]