SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03085T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_03085T0
Domain Number 1 Region: 1214-1290
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.49e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00052
Further Details:      
 
Weak hits

Sequence:  PTSG_03085T0
Domain Number - Region: 875-978
Classification Level Classification E-value
Superfamily Tropomyosin 0.00294
Family Tropomyosin 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_03085T0
Sequence length 1293
Comment | PTSG_03085 | Salpingoeca rosetta hypothetical protein (1294 aa)
Sequence
MSWWRKKLNELSGTRAEDEDDPGRQRALSDKQTFQCTMCQGQYFDSIEDLQNHYLVAHAS
DEEAEAARSRAGTASSATSRGTPATVKRGVQDHGRLSDTPLIDLDSASSCAVPTPAGGDV
SAELLEARTKLQEETYHNRELQKELTRVQTELERLQRTTAQAQSDTKELRYLRRENLQLK
SQIETAAKKQKQTAGGSAVDTDELYEQLHVMEQQLTARTAELQFIADERDAARKELEDSR
ARVDELLRNQQELESSIQQLQAQAADTEALTQELDARTQETAELQSKLKELEITREDHRG
GGDGDGMDVNDGGQDGDGDGGGVGDDGVPRLKETVASLEAALKAKEEECSALLEQQQAEK
QQQQKRKTRAEEKGRKAAATAEMEALRKEMEALHGEVAQMQMSLNAAVAANKDLQSRVHA
YEQQQQSAHQADKNQGKEKTESDDTGDDGVEGSAAQYEDECEGETASQQVRDVDGDHHHD
TAAAVDTMKSEWAAERKALCDAIEALQQQVAAANEKEEALVADTRAKLEEQQQAAAQRKA
EEENTRQREHEQEVQRMQQQVESTEQARQALEEELASTKEQCLQATKKTEQLQAELETAA
RARDMAGAELNAIKEEQKLQTSSTEAQAQQQSEERKERERALLLSRQEQKDRLKAALSRA
EQAESELEASKTQMASYAARVNELHTQLQSAKDATKAEREEKQTAAQALADAHASLRTAE
TTIAAKERELVDLRSSDEQRKRLQQQLDALNKEKETLESTVAAANANIASLNATIESGEQ
QRAELLGQLSEYKAQVEAASAEVDSVRSALETRLANVDKERKKLAEKVKKQIRLLDEKDG
ENATLKSRLDEKHKLEHEVETRLTKHEEAMTALQSKVMEAEAKLAMPCEMCRSYEQQIET
LNATIASLRSTQGKLERQLQDSRDHSATLQQSLEEQLVYLDEASKQNGKLAGDLTQAQEA
LAATRAELEGECATLRATIDEQKETISELEKKLSSVRIELQATSHHKTQLTQEKEELKSR
LAESAQETQTAMDDKTEAEVMLEETKKMLVSQKMKAQNEIEALQARVADATSRLDAAEKR
NESAQQQWQSKLDDLREALNAESSDKRKMKEELQRASHERSQEVEELRSELSRLQDTFAS
SERRAQESATKLRQMVDMEDQLKSTLQDVNREKQEVLARAMKLEQDVSRLMQSNKQLTKD
GKNAQSALEQLTARYQEVLQQLNRFQERSWVDDTEVKNCEACHKLFSIKTRRHHCRQCGH
VFCNSCSSNTAKLASSKKRERVCNACFEEIQKL
Download sequence
Identical sequences F2U473
PTSG_03085T0 XP_004995675.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]