SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03128T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_03128T0
Domain Number 1 Region: 749-999,1086-1116
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.11e-63
Family Protein kinases, catalytic subunit 0.0000686
Further Details:      
 
Domain Number 2 Region: 54-339
Classification Level Classification E-value
Superfamily Kelch motif 3.92e-23
Family Kelch motif 0.018
Further Details:      
 
Domain Number 3 Region: 370-573
Classification Level Classification E-value
Superfamily Kelch motif 0.0000000000000144
Family Kelch motif 0.015
Further Details:      
 
Domain Number 4 Region: 653-692
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000285
Family EGF-type module 0.039
Further Details:      
 
Weak hits

Sequence:  PTSG_03128T0
Domain Number - Region: 600-637
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0148
Family TNF receptor-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_03128T0
Sequence length 1118
Comment | PTSG_03128 | Salpingoeca rosetta predicted protein (1119 aa)
Sequence
MTMGAQQAQGQRQRHRRQRPRDVACLLLKVLTMAMTCTTLLASPSIAQNRAVLNAWTLAG
SSRVIPAPRVGASLMSPSNNVVILYGGLTENEESNDEDQLLALGDLWSYNLRDDNWVQLP
TPQGIEPRGFHAITDLFVVHMRAFIFGGYVPADENSSVAMVPSDTLLEVRGREPALTITE
IPKPTDPDAPWPSPRLLHTMNQVAPQNDVLSRCGVVFGGLGANNTPLGDTWLYNPETQVW
TELTGTPSPPARFAHITAIVRNRIVMLSGCRVAGDSAGCPEGQLPDVWELTVFDGACTSG
QWRRVANLTVTAPGRYFGGSNTVAIGDDLIAIGGLQGDRRAYYHLKITATDAGGVQSVDW
GFNAINFASIVPPAREGFSITQTHRGGGASDAAVMFGGAAPLSFLQDTWRFGTAGPFWSP
SVSDRVVPLELVLPGYAVSGQKAYIVGGQTVSGERNRGLWEYDLATNAWKLLNGQLNNDA
GGACLVKLNADTLATFGGASDLPTGFFAGYSVLLDHLLIVHGGLEQNNGSWVATRDLFTL
QHSEIGWSWRELSMANLPSSDRFGMAAFVLETQPPVFTVAGGAALTAQQLRPMQNQHTTL
LGCNAGEFSPVFGEYVCRPCPEGTYNDDAGATRCVQCPGISTTVGEGAVEEEECNACRPG
TCVHGACVLDVTTQVFDCLCNSGWAGSRCDVHVAAILAGTTVSAAVVAVAVFFITRRVKR
GFSRMQKLQDLQERLIEESRVELSELKRAWEIIPDDLTFLRRIDGGSEGAYGEVWLAAWQ
DREVAVKKLRSSILSLDEHAIDDFDAEVSLIRSLRHRNIVLFYGAGVMDEGPFLVTEFMA
RGSLSAILKSNVELSYSRLLGFAEDMVHGVMFLHELQPPRMHRDIKSANLLVSENWVVKV
ADFGTGRLCGQEQATDVVAAMDFASATMTTAVGTLLWTAPEILSSQPYGPPADVYSVGIV
LYEIATRREPYEELHDTSTWTLREKIIDGVRPSAGLSTADTAVAGAGGLLADLSDDANGG
DEAKAHVHLQKRDNGGVGGAHVQFADRTDDHGGVQGGRGADDTEHDEPLEAPGDITTDRT
PLAHEPRFVQLMQACWAGRPEERPTMRQASQVLEVLRR
Download sequence
Identical sequences F2U4B3
PTSG_03128T0 XP_004995715.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]