SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03202T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_03202T0
Domain Number 1 Region: 7-157
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.31e-28
Family YicI catalytic domain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_03202T0
Sequence length 169
Comment | PTSG_03202 | Salpingoeca rosetta predicted protein (170 aa)
Sequence
MGAVGAVDIDSTWEVGFNNFEFNTDKFPNASAMVEEFHKMGVRVIFWITNMIDTDSPNYQ
DGYNKGYYVRNVLGKQGTVKWWHGHGSMLDYTNPEAVAWWHKQMDNVLDIGIDGWKCDGT
DPYILEFVTPHGYNGSIAWHEYSDMYYGDFFDYTRKYDRLPACAHVLMA
Download sequence
Identical sequences PTSG_03202T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]