SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03209T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_03209T0
Domain Number 1 Region: 1160-1269
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000628
Family Cadherin 0.0064
Further Details:      
 
Domain Number 2 Region: 56-155
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000004
Family Cadherin 0.0093
Further Details:      
 
Domain Number 3 Region: 886-922,967-1021
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000228
Family Cadherin 0.011
Further Details:      
 
Domain Number 4 Region: 1600-1643
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000288
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 1859-1906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000144
Family EGF-type module 0.02
Further Details:      
 
Domain Number 6 Region: 397-491
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000971
Family Cadherin 0.0037
Further Details:      
 
Domain Number 7 Region: 1816-1861
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000139
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 764-857
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000228
Family Cadherin 0.0063
Further Details:      
 
Domain Number 9 Region: 504-543,571-625
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000271
Family Cadherin 0.0095
Further Details:      
 
Weak hits

Sequence:  PTSG_03209T0
Domain Number - Region: 1059-1157
Classification Level Classification E-value
Superfamily Cadherin-like 0.000134
Family Cadherin 0.011
Further Details:      
 
Domain Number - Region: 627-679,711-762
Classification Level Classification E-value
Superfamily Cadherin-like 0.000471
Family Cadherin 0.01
Further Details:      
 
Domain Number - Region: 1528-1569
Classification Level Classification E-value
Superfamily Cadherin-like 0.011
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_03209T0
Sequence length 2421
Comment | PTSG_03209 | Salpingoeca rosetta NOTCH2 (2422 aa)
Sequence
MPAVVVVRSRRSGVSNSSLRCAWLALSVLCLVLVCGVPGCSAANSRPYLVQISPNKVPEN
IPEGDVIAQLSTIDFDFDQTHTYQLKSTHGGRIALSGDKLVATSIPLNYEVAEITYLEIV
STDNGSPPLSQTFQVPLRITDRNDPPHRLTLSNPIITKDLNASDTIGSFTVADQDNNRNR
NWLTGRPTQTHVIELCPSSSFLGSFLSIDSSLNLVLSGAVVGVPEQFDACFRVTDSGSPP
ESADFTKTLIWEGSAKPPLLITFTATSIEETTPVSTQAVGGVVGQAIAYHPDSTAVIEFA
TLPADTLAVSNDTAPTCAVLTASELPAGVTVPDYISEVARCSVDVVLVRPLNYEEDDANI
TVTISAQDVNAQLPAFATFSLALTDANDPPDGVLLASTVREDVQRFQLISPLVVDDEDAS
QTHTITLLTATLQDGAPCPAVIVAGDTSLLANDTACFDFERNPIIALSVLVTDSGTPPLS
AVFNLTLQVLDVNEQPALVRLNNTHMPELSPANAVVAEIAVGDPDNYNSAVQGVACRLLD
ANSPFAIVAPANPLAPPSSSADEGSTNSGAGEFVGQLVSGGVVVVDRPFLIDYESAASHE
LPVRCTDTGSPALSRTITFTINITNVNEPPTALSLSGTRVAENMPAGTAAGFLFAVDPDD
TTSGGSGSLEFCVVEVTGAATQQQQQPPSTAPATVTTVSGDSGRGGGGCTARDESAFRVV
GNRLETTRPFNAEEAPLLHVRVRAADQGGLWTEREFDVTVADQNDPPLAIMLTPTPVREN
EAGAVLGSLATVDEDASQTHTYTAIVEEATTPIDVIITNGSTLQLAAAQALDYERTPLLR
VRVTSTDSGTPQARSISAVFDIPVENVNEAPTSVQLQPLLSLGHATTRLVVPEDTPVGTP
IARISVVDPDNTPYATEQQTHTCRVTAIATDPDNTNTNNNNSSSSSSSTTAVPSSSPATG
DPSTSVVVVVTVVMVGNTTELHLAQPLDFENTPDMLLRVACTDSGTPPLTASSDVTLAIS
NVNEPPSIAFLPAATLNATTMSPGSTSVGSGMSQSGGMVVVRVRENTVAPLLIGHARVSD
PDDCASLRCGPPSTFTFTASPFDIVQVLSDKRVVLKRPLDFEAAQRRLLMLTVTDSVDDP
TKDSPITARVNVSVVVEDANDPITAVSCALTPVPEDASPGTQLGTCTVSDQDAPTTAYGR
HRLSVEWTNAPSPLLAQHGIYADQDSSTLRLNASLDYETTATLQLRVRAQDVSASPLSFE
TGISVPVVNVDEPPQVQLSIRKMPLEEGTYTQAELARITAAVDSEGAQVSCTAAPAPGPV
HTTTTYAGGNAGGGVDEWARPVYCRDSRREGYNVSITTANAVVLSGTVDFECTKHANVSL
TCSDGTTEAVTFIVVPIADVAEPPQAAVFTPSQALLPSLAAISPAPVFTATTSVANSGNA
TTTPHAVAGVGDPMHVAFIEQQAAAAGEGAGVTLGVVGCVAGTSNGCTLTLARATVAAPL
AASPSLSSSSPLVVPSTRPAVDVAVSGEAAVVSLDAATGTIAITDQRLNYEAGAVWTLTL
TANDNGVGGDGVSVVSSAEFTAVIVVRDAPEAPTAVSTLCGCRDTPCQNGGRCVEPSEDL
TGLTFTCMCPPGFAGVQCEAAIADNAGDGTAQANDGGSLYCLRVGAGVQTGTTLARLVVA
DEDIGDTFSVEVGGPLSSGLSVTAQLDVVVTAPLDALIATALPQQQHTLPASLPVWLLAT
DAAGLRANISATIAVTPCAGVLGACGPDDTCRVDVASGDATCECGPGFVFSQAESRCVER
VCLHAREGEVCTALTDTCASGQCENGAICVDGVDSMGRNTFQCLCPAGFGGFRCDELQTS
CSQQPCLNGGTCNDNTADSGYTCVCTASYTGARCQYPANACDNNRCSGLTVCVPRPAVTD
TEGTASQSAQPYTCASQQSLVELQLSAASACNSGDDGDGSAADASATCGQDQTSAVELTL
GDATPDGVTVYVVGSARVDDLHIITLAVIDPVTGATLDASVVTHLLLSYCSNATTTTGDG
TGTGAANATSMTTTTTAVPSTTAAAPAQTQAPTSAAQASASAGATNPLCDPGSVVIIDSG
TGSLTPSTTGQLPLSTSTVPVVSTTTASPTTANPNAGASAASVSPGVIVGYIFGALLLIV
FALLTISILRRRAKNESVVINFDDGKKHRHQQEQGRTLEAANPAFLRTPNPWLEHEEHVT
DTRSDHHDLTDGNDRAEKTSARRSVYAASRSSEQPRDDAAGVGEQHEQREDDPRSSVFEA
LLSHPGLVYSDANGTAGGEDGEADPLHGVRRRRSSAAAHAPKRRSRFIGDSDDDNSDASS
DDDDTDAGDGGSPVLREEDEDVGYIEVESVGPDGTKSVRRVRRPADDGSGGLNDPVILNP
LFASAGLLNDSDDKHDDAGAG
Download sequence
Identical sequences F2U4J1
XP_004995793.1.12839 PTSG_03209T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]