SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03216T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_03216T0
Domain Number 1 Region: 1068-1112
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000215
Family TNF receptor-like 0.005
Further Details:      
 
Domain Number 2 Region: 901-937
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000432
Family TNF receptor-like 0.0051
Further Details:      
 
Domain Number 3 Region: 271-322
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000706
Family TNF receptor-like 0.0039
Further Details:      
 
Domain Number 4 Region: 1416-1453
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000011
Family TNF receptor-like 0.006
Further Details:      
 
Domain Number 5 Region: 324-364
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000471
Family TNF receptor-like 0.0045
Further Details:      
 
Weak hits

Sequence:  PTSG_03216T0
Domain Number - Region: 406-443
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000139
Family TNF receptor-like 0.0054
Further Details:      
 
Domain Number - Region: 765-931
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000188
Family Growth factor receptor domain 0.0042
Further Details:      
 
Domain Number - Region: 1369-1418
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000334
Family TNF receptor-like 0.0086
Further Details:      
 
Domain Number - Region: 532-571
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000377
Family TNF receptor-like 0.0054
Further Details:      
 
Domain Number - Region: 1285-1327
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000968
Family TNF receptor-like 0.01
Further Details:      
 
Domain Number - Region: 944-986
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00184
Family TNF receptor-like 0.0075
Further Details:      
 
Domain Number - Region: 1026-1062
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00278
Family TNF receptor-like 0.0074
Further Details:      
 
Domain Number - Region: 446-477
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00706
Family TNF receptor-like 0.009
Further Details:      
 
Domain Number - Region: 1458-1501
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00785
Family TNF receptor-like 0.0081
Further Details:      
 
Domain Number - Region: 984-1018
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0255
Family TNF receptor-like 0.0063
Further Details:      
 
Domain Number - Region: 666-691
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0494
Family TNF receptor-like 0.0082
Further Details:      
 
Domain Number - Region: 1211-1271
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0549
Family TNF receptor-like 0.007
Further Details:      
 
Domain Number - Region: 690-749
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0628
Family TNF receptor-like 0.0049
Further Details:      
 
Domain Number - Region: 642-667
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0673
Family TNF receptor-like 0.0048
Further Details:      
 
Domain Number - Region: 1047-1064,1163-1211
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.1
Family Di-heme elbow motif 0.042
Further Details:      
 
Domain Number - Region: 1140-1164
Classification Level Classification E-value
Superfamily TNF receptor-like 0.1
Family TNF receptor-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_03216T0
Sequence length 1660
Comment | PTSG_03216 | Salpingoeca rosetta predicted protein (1661 aa)
Sequence
MRLPGILRLWNNPDSDTECVCQASCGSGTISADCSRCECEPNQGCKGGRCRRYITSTGDE
PLAWFDDFPPTCTNCQCLDIDCNTTYSNAWPDSIGYCRCLSAQATCDVFGCQSGHILYGR
FIRLFQESCEECVCNEAQPACSQPGINLADIRDDWVFEGSLDCTSGDPEPFTLTDLRWED
GQVTASIYTTVSGHIGGWKLRSSFFNNDTGCVYLDRESGWVINPNNGDDVKRYSQVSLRG
QFYNDGTTLRFDGLIPECKSSPLASSLAAPCDYNTEYRNYRGICTPLSDCGVGYQILTPA
TETTDRVCAPCTTGTFADSLNQDECTAWTNCVPGNEESVAPTSSSDRQCIPCGSGTYSDT
VNAESCTSHKQCPTGEAEVVAPTPSSDRVCSTCDGVNTYEAPDGDGCIDISRCDPGTYET
ADPTLSSDRMCAACQSGKYQSQPDEEECIPFTTCHAGSFVTLLPTSSSDRVCQACDGVLR
YQNETNALSCKSVTTCGSGQEEAVPPTPASDRSCVNCVLGETFKVEAGSSTRCNNVTTCD
AGTQENTAPTISSDRQCEPCPSGSYKETAGNFPCRVSPQGTYKATIGPEACSVWTECNAD
QYESVSPDASTNRKCTDLTVCGADEFELEAPTETRDRVCADCSVCPPTHEETMPCTDTSD
TVCLECKTCPPEEYLVVRCSNSTDGVCGACDTCGSGQYEISPCKDSRNRVCADTTPCTET
QFEYQPPTVTTNRVCTNFTVCTPNVQYEAVAPTATGDRMCEDISPSCSAGYEQTQDPSST
TDRECRMCPAGTIDHDSDPLTPCVGCPTGTHVLAGSFGECSQFECVPGKADLDRNASTHC
ETCPSGTFQNLHGQTECNPWSSCPPGTQAVPGSASTVNDRQCASCDLGVTFSDTNTTAEP
CRDVTVCPAGYHEDTPPTLTSDRVCVPCPSGTFSATVGQGLCHEWHVCEAGRGETTAPTS
SSDRVCSLCQLGTTYQPHDNATTPCLVVSECNPGFEETEAPTLSTDRVCQQCVLGETFKA
GVGEGDCQLVSSCPPGKEQKTAPTLSTDRECQQCQLGVTFKALAGQAPCITTTACGPGKY
MTVAPTRSSDRQCMTCESGKFKSSASNQDPCLLVRPPCEEGEYQSRNPTPSSDRECSAIS
TCAEGYFEFLPATATSDTQCEQCRQCPEQHIQIAPCNRTTNTQCEGCSSCPSGHFASRAC
TTFNDTVCKVCSSCALDEQYHLQPCTETSDTVCAPRSTCQPWQYDAREPNSVLDRLCTNI
TACKQGEEYETAEPTATSDRVCLQATECELGTELVSPLTPTSDRVCRACPRGFADHDLDP
STPCEACAVGTYSDEQQYGRCEQCRLGTSEEDADPRTPCTTCEPESYQNRIVQVGCMSAR
VCGVGFEEALSPTVTSDRVCVACSNHTFKAVPGNDIECKPFSKCGPGTQLVSHGTATHDT
QCEVCPLGKWKDDDSEFPCNPVHTCFDGEITAIRPTPSSDRVCSACAFGTYATSRSDDAV
CADWTDCNRAVQFEFVAPTSSSDRQCADLRTCTETQYEDAAPTATTDRVCRARSELHTFR
VWMNASYVEYALASPSHELESALESTLRERVAAVRGYVEVVLEENSVLAEDRTVANVSAR
SVAARAQVEALGEFEVEVQGTAILSVLYTEDEAIAARMGT
Download sequence
Identical sequences PTSG_03216T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]