SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03311T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_03311T0
Domain Number 1 Region: 492-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000141
Family EGF-type module 0.02
Further Details:      
 
Domain Number 2 Region: 332-385,421-545
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000126
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 291-339
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000324
Family TNF receptor-like 0.0084
Further Details:      
 
Weak hits

Sequence:  PTSG_03311T0
Domain Number - Region: 1207-1227
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0392
Family beta-sandwich domain of Sec23/24 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_03311T0
Sequence length 1399
Comment | PTSG_03311 | Salpingoeca rosetta conserved hypothetical protein (1400 aa)
Sequence
MACLQAFQIAVCVLIVALGTPQVHRVTAETTVTGVLTLVRFHATFDDTATYPTNGGDDNW
INPTVALLVGEQPADRHRLNQAVDESSPWQVEEPWENPIHWPRAWEYLGGDPVVTLDADQ
AVTIQFGTWRFPPSTTSLIPYVEDTFSPLNCTFNQANITFSCTAHGKPNEPTDAQFPAVF
TYTYTYTCDATTSCGDYATCNTTSGQCVCDEGAASPAGHMFDCQPLCPEGACVGENAYCD
PSESVIGDPACKCNTTVNPRLIYESGVGCVHHCSLGGDYCADPDTECIGSACKCKENLYL
DMGTCVAKKSCPAGEFATDLGDATNDRECDACPPGFYCPGSGDDPGPAFAFVCEGPQYFG
AREGQSECNTTQPGYFSTSSSEFVRIDVYTASASPTPYAGTARFSTIDLYVKEQECPAGI
VCQNGERTPCVPGTTFQDEPGQTMCQPCSTCDLGFEVDNACEVTRDTECKEIDDLQQHRG
LLRVHCNEGFEGNGTVCVNIDECARGTHVCHPNAICIDTIGSYTCECKPGFVGDGVGECV
DVPPSVQLLGAASSSIVFEDGVVYVDAGAAVNDSNVPVPYYVSGWGALREALGQGMCVTG
SPVLEYFVRDGEDTRKTRSVGVVYGAPAVSLVRGERVTALQLVQGATSECYEATDPSRVR
VVDAFGDEVSVTTSFTAQPQPFLCDSLSSTTSFRQRVDYVGSACGVNGKVELEFAWFDTW
APKVWVGAGPSEVAVQVDTARTFSGTGALCSASAHDFGTPNVTVESTWGASGAVDPSVIG
EHQRWSWARDDEGLVSRNVSCRVRVLDTMAPVLRVPNITAGAERVLVVEQSATTLAFADA
VVEDAHDGTQVVGATPSSVSLGAVGTHVVRYEATDDSGNGVGGGEAHAVRVVVREQASEV
AGRREPDVVVGDDDGNGDSVSVEETFTASLSLSNSNSNSDSNAGRRTEGDAWVVDEGRAS
FVPGTHVEVEVGGDDGESVVQHVRRVVYPSSAEVTMILYDDGIGGTREETETLIRAAFDD
VARPCGRVYVLDIDFVGNVVELVCVDGSGALVRLSKDDVPAAQRNLFTVVQTGSDDRPGT
GGGSSGNSSGSTHVLIGVFVAVIGLLIAVIILLHRRRRSKQSNSVQEVQAPDNGIVATGP
DLHMHRWNPVFYDTVGVVHGDDAGGVEQVTAPHVYESIEDGDPESIQATLRALDFEEPPA
RPEPAHLSNRQQQQQQQQQQQQQQQQQRGGGGSTRTQSVKLRTKDALWRRQRQERERRCH
SAGVTHGGMIGSVLHGAPSTLSAATMRPRAQTRTTPSEAPAAPTQSEAAATVSAAAAAGR
TVHRTRAPKRLAARQSLRLASDANLMAESSSDPTPVHTWSVNSYDHTTTPTSAARREARR
DANRRASQYDIVEGVTPRQ
Download sequence
Identical sequences F2U4T7
XP_004995889.1.12839 PTSG_03311T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]