SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03456T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_03456T0
Domain Number 1 Region: 849-978
Classification Level Classification E-value
Superfamily C-type lectin-like 2.93e-31
Family C-type lectin domain 0.00088
Further Details:      
 
Domain Number 2 Region: 120-272
Classification Level Classification E-value
Superfamily C-type lectin-like 1.43e-26
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 3 Region: 340-400
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000167
Family Complement control module/SCR domain 0.0047
Further Details:      
 
Domain Number 4 Region: 521-588
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000917
Family Complement control module/SCR domain 0.0049
Further Details:      
 
Domain Number 5 Region: 478-532
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000139
Family Complement control module/SCR domain 0.0049
Further Details:      
 
Domain Number 6 Region: 686-727
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000208
Family Complement control module/SCR domain 0.0038
Further Details:      
 
Domain Number 7 Region: 781-843
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000306
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 8 Region: 741-787
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000598
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number 9 Region: 394-460
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000653
Family Complement control module/SCR domain 0.0035
Further Details:      
 
Weak hits

Sequence:  PTSG_03456T0
Domain Number - Region: 288-335
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00459
Family Complement control module/SCR domain 0.0097
Further Details:      
 
Domain Number - Region: 600-655
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.025
Family Complement control module/SCR domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_03456T0
Sequence length 1198
Comment | PTSG_03456 | Salpingoeca rosetta C-type MBL-2 protein (1199 aa)
Sequence
MKLTAKIAVLFGGLFALASHTIASTPCDPSSDCCLTGFAQVTVEDFGLTTISAQSEGNCS
QAQGVVTILCVRDAVTGSCPHPLYDVSLAHASLTIVAPDGRAQNATCVSGPCDGHPVNVT
GVYRFADPAGWHYYEGSEYLFKDTSVDFDEARAFCQSLGADLPVVDTRQENEFIDSLTRD
LTESVWLGAHLLQDPLRVTWVDGSEGIAFENDTFYDDCTFGVDCLFQKNEPNNFNGEEFC
LSQGHPTKPGQSSGWNDADCSVRKSIVCERKILCSSRLGLDAMLQTDCVLPVPSGDQCNA
RCEAGFEPQNPVLITCSNEGILVGGPTCEPVDCGPVVTTLPANATADCSSLIDTRYKGQA
CEAQCDVGFELQGDPTFTCGTDGLWTASMTCNPVDCGPTPDLPNNTVADCSASTVYGGQP
CHAACAPGYETTQESEDGIYTCTADGEWVGEISCTRKDCGTTIADLPVNASANECGGDTA
FGGDDCEASCDAGYEPVSGTSTTFTCGTDGMWQGDLACQPVDCGSTITVTNGGATCSGST
VYTGDDCEASCDAGYEPVSGTSTTFTCGTDGMWQGDLACQPVDCGSLSDFISDAFASVNC
ASSTFTSTCSATCVPGYEPSPESNVSSTDSAVAEFTCGPFGSWQGALDCVHISCGSISDA
LADEFVTLASDSEECALDGNRCPAANVTCPPGYELSTGGSVHTMTCKIDGAWSESPTCQR
VSCGPFVPNLDPEAQQDACLDFRFGDVCEIGCRAGYVSNGDADQGVFTCDETGEWQGTLT
CDPVDCGPMPSGLPDNITSQCSNTKLGDTCELSCDAPFFTKGSNMFKCTEQGVWIGGCDL
ECLAFDVATQVGDSVFAFIETPMTFSKAQVNCLELGGNLASVSNDAENDAIFNLNPVIEA
RWLGGFVPEGDEHSAAAFQWVDGSSFNYTNWASGEPNDYLQKEDCTSMHTLSGRNALAGE
WNDVSCTAKIPSVCEINVAYHGADPYSCDAPFELAFSSEGFFNPGFRFSTAFEPSAQEFE
VTYSDTDSITAYSACSDHCLQNTACVGFYLQTQGDSFLCIGLNDLGYAQQTTVTSSSYAR
TGYPVPGTTSTTTTTTTTTSAYACTEYAGFTIEMVANADCQVPGDGDLVTSAYSNPLFHI
GTYADGEVDQCVSDCSSDSECLLFVVEYVDDEERCTTLRYLGIEEETGLRVVTYHKQQ
Download sequence
Identical sequences F2U591
XP_004996042.1.12839 PTSG_03456T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]