SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03468T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_03468T0
Domain Number 1 Region: 1379-1445,1484-1613
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.42e-39
Family Ankyrin repeat 0.00018
Further Details:      
 
Domain Number 2 Region: 323-355
Classification Level Classification E-value
Superfamily Notch domain 0.00000222
Family Notch domain 0.0036
Further Details:      
 
Weak hits

Sequence:  PTSG_03468T0
Domain Number - Region: 34-111
Classification Level Classification E-value
Superfamily EF-hand 0.000582
Family Calmodulin-like 0.02
Further Details:      
 
Domain Number - Region: 164-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.1
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_03468T0
Sequence length 1650
Comment | PTSG_03468 | Salpingoeca rosetta conserved hypothetical protein (1651 aa)
Sequence
MSARHLAAALVLVAAVLWSAAISCQATEETCNDQSVLLQIEGLFNEMDSDNSTTIVSAEY
TAYCASDINGTCPNISLAFSFDTDGSASLDPHEFRTLVCSLLLNGTDIAANATTTSAPPT
SGALSTTATTSTCPFGGCGVGVCEEGRCVCPSTHTGDACEFELCADTPGDCINGGECIQH
SFGGQQTQECLCPSNAWGWTCEYVECDQGMYRNTNTDTCENITACAYPAQYEAQPATRST
DAICLAVSPACDFPNTYEAQAPSETQDRACYPVMPCVCASGWVGAACEASANTAVVNSRG
NITDLNRIYRLSNQEATLINPWHACANQTCRTVFADGVCDPSCNTAACVFDGDDCVAIAP
ICKQVAAGTCTFGGDACNPACATSECLWDNNGCGTWDTGDNSLAYTLRLFLDLELSVFTG
RVQSTFAYRLSQRLDGFVTFAAVRQAVMFGPSSSPSSAASAAASSLSSSPSLLSASSAIA
NRPWRARREGDVASRPVLQVDATITPRCSVRCITSSQAAAGYVNAIVAAGASSSDLGVPV
LRAQATTSGNGGDGGSGGSVSVSPAGAATIAGVCLLALGVLVVIGVVGKGAKRRVTIEAI
ELHEGGAHTSPPPPPPQVDDAAAWSDGGPLPAKRARHHHHQQQYEDSPQFSGRMATAVSS
SSSRLLAMRGDDDFDPNMDHAAYPRFKSSTNTNSSVTSPQHQHQHHQHQHQQPEYQPLPR
RRSSSVSSSSSVAALIRTLSRSASTSAKVWPAPQPPAYTEHDPHQQQQQQRQQQHQQHLQ
QHQQDQHQHHQQHLARGDDALFSHMGAIGEEQDDDGCGGGETALDAFINSQAQGECSTTT
GTTHHSDSSIPGTTDTWMGSEHASMANSPAESACTGSSVHGSAMATNPLLLDNDALDFAV
FSSDAHALMHSDHQHGAYDDAHNVRFDRHHHKPRPVLSPIVGDVDLDQQQRYGWQSDGAD
HAGPVPVIGVGDGDVGGDDALRPAPLWSPHTTAAPPPPPPMMALHGDDDGAITNDEDLIR
ACARDLAAARRSANIGVVVANTHARAAGSVADPQQQQQQPDVHVHPSRYLHLQMTGDGSS
LSLEQLCTDITPVLPRRAIPARSERQHSTQRYEQGSDAVGPAVSHAQQHESSSLSPLVRG
GEWSSPGSSPGDGSTTASTTPPQGHTPRSHADDDDNDDDNDDIAHDGDTSGGSSAQGHVH
AHASPRESHQPPRTAAPAVPCAPASSPLARACTTASPTSQLPPPQEQQQQQQQQQQSLWS
ADDARNEQRELLAACASASAVERGAIFTALLQLESAASLSSSPSSSSSPSSASPSARGAI
AIATTNTTPSSSSAPSPQQIGDDEPTARGGDRGDGPRAGDGAGVRAFLRAIPSGELLCVA
GPRGETLLHMACEAQCMPAVRVLLADAVRASALLATRDDDGRTPLHIAASVGFEPGVEAI
LSLRTPQPRPGAARGARGARGGVHSRDGNKGQRGGPSADVDVDVEVDVDAADSTGASPLI
ACVRQRQLRCAKLLLRAGSNPDHRDVRGWAAVHWAAVQNDASGVKLLLAYRGDINIKTNN
SQTPLHLATREGNVKVVQLLLSRFAKRHVEDAFGQTPAGLAREMKDTAVLQAFSSTTSVS
GRGGQALRSKRPAAPKMPLLRRGSGGGSTA
Download sequence
Identical sequences PTSG_03468T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]