SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03475T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_03475T0
Domain Number 1 Region: 96-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000592
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  PTSG_03475T0
Domain Number - Region: 35-100
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00733
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number - Region: 685-748
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0667
Family Carboxypeptidase regulatory domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_03475T0
Sequence length 2134
Comment | PTSG_03475 | Salpingoeca rosetta hypothetical protein (2135 aa)
Sequence
MPGLREQIEDRVWSYQTCRVSCNRDQGYSTNGRSCEGQSCGALSIANGVVEGSCGGTFGD
VCKFKECNPGYEASVFGVISRKCDWVGNGLGWSNVGKECLDIDECLTGDNVCYPGSVCIN
TQGSYYCECEFGVQQGESCFVAIPTITLDLGLTEMTININGEWGNTFPKYRVSVARWSYD
LAAKEDIPGFPKTIFKPFTSHRVINLEAGSRFRVTLTPVDHKDEEIPYFSQLALTPEGND
PQTICGCIPEDPTGAPTDFTLKQFKGHVLFRWADQSQCESAFSFTRNGVGLTSRFPVTEQ
LACGAIQEPNTVYDDLTIQSAGDYAEVDEALNYLLPEGEFYLRRFLAVDTGDTRFMYPHE
LQRQKTHFSSTSTTTTAAPQGVPDDENRYYPGTSSPVASVSECKDLCDIRSAWCIAFVVQ
TKSDDTLVCHQLRVIETATLRAGEKKAVSFERVTVTGTGVDGSYIFDGTQDDCEEACSAH
GSCDMTMVAAGVCAVVVDAVETETPLTQSVHPDIDPTFSRRIPGPEPGTTQEYCIEANKP
QWYDLQGYSSDPTCTSFTIMWESQLEGQIAIDSKEIHLPVEGVEVEFEIGGLVRGRRITN
EDGKFSIHILSDKLVGSRHRMTLRFSKTTGNIKHTFTCGGIACTESTLIMEHLRFDHTVN
VRDTTSLPFSGIVSIGGTEHEGLPDGCPLKDVEVCLYDRNQANTLINCDVTDSKGRYLVR
AVLGTSVTVSLAYGNSSHTFERVTYDQDAANAPSGILQTINALNSLERTPYYDVTDGKFW
ENINFKDTMSDRATVDIAGGLCNLNLGDAVIEFRYDMCPTWVKSRTISDRLSKWTLPAQI
ITVRFKEITRNYEVRGEITRYFSAKLGNSRSLYLDLRNPQEDDEDKKTVRFEYHPPPQLS
VEFDKEEKHNCNSTEGDRPLHVIKQNVELKATVKVIEDYGEGVGTCDAVPGQIEVENQLG
ESPAIVDVLNASTSLTDKQLNKLKLCYDTCLMDVKMDEELQDGETVYSNTRIELSIMTGE
PETNPQAVDPENPYSKLFRVTMHNLPQDPVTVYEKVVVIGDKVISKFFSVPFPRYQPLAV
VQDPPGGLSTVTYSKAYSNYFMKSHTHEEYHGFYFTTGLAPVKVETGVEQCAGLGAAVCT
KVADTESTPFKISVDQTHTFGSMDPDDNYNSERVWSFAIELTTSDDVMTAGEKSDMFLVP
ALNVVWLETEEVSFDAEQCQAAKETKVKWSLEGQENREVLSWVSAFEIENKELPDLRKLL
ALAEQPPGDDDDETEEDREEKIAELKRAIKAWESNLDRNKEVRQKAADGLLDPVQNMWAK
GNAEFDCLPSIAPNKDPKKAAKIEGQLSKTEVCNGFDVGRIADKAKKGISLAPHDDIDNA
KDLDGLAASDQDKQDLRNIDTIKFSGGGSTYTFEYDLSRGDSVVGGNSRTHEVSVGVDVN
FGFKVFGVGMSFELSTGYNYEGTVADEYEAGVSTEGTLSVTLGDPDPFDVFDVGIFLHPD
YGTFVFATFSGQSSCPHEPNTVQLEQPGINVLKRPEAPVLPGEPAVFELLLKNDGPMTSD
FNLFYLSWLNQDGLEVVANGQALETALIFEGFPANSARYITITVNQGPSKFKYDPVAIGW
RSLCEADRHPDNGYITDEVTSVEYVYLEAEFLQPCSPVKLVGEIGESGAFTLNQETMEQD
YKPGQIRVVAFNPDHAERTWLEDDRLEKVVIEFKPANSYIWLLARDENGDALDIRERENE
YGYITAWWDASTLLEGDYHLRIRAQCQASINEMPDGIDEKLSSVALGVVDRDPPVVFGFP
EPADGEFFPGDEISFQFNEDVECRQPFIFQVSLTVEDYDRDFNNNNMVIVCEGRKISMSL
RRGFRYDEVNGLSATVVIENVKDLNDNQMEFPPEHTFTFAELNLADASVTLSGLVVNVPY
QDVYADTTSQEYADFAGVLQTELATVVDTDPSRVTITGISPVDATNYNSGITVSLRFTPE
GTDTAATGRRRRATTSTATDLASLLQSRLQNATYTESLSVLNSASLDEAATVDVEPSATD
TAQNDAASANTGATVSPSATTSSSVSKWTDIKLDVAIVLLVCLLVLAIISLVKDKVKKQT
ADKEVDQPFRSLSFFRRPQRSSRVAPFSVSESDV
Download sequence
Identical sequences F2U5Q2
XP_004995207.1.12839 PTSG_03475T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]