SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03507T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_03507T0
Domain Number 1 Region: 1970-2066
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.0000000538
Family Cellulose-binding domain family III 0.019
Further Details:      
 
Weak hits

Sequence:  PTSG_03507T0
Domain Number - Region: 2397-2436
Classification Level Classification E-value
Superfamily Defensin-like 0.00267
Family Defensin 0.015
Further Details:      
 
Domain Number - Region: 790-819
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00895
Family TNF receptor-like 0.0057
Further Details:      
 
Domain Number - Region: 1056-1172
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.068
Family Cellulose-binding domain family III 0.019
Further Details:      
 
Domain Number - Region: 2702-2818
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.068
Family Cellulose-binding domain family III 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_03507T0
Sequence length 3175
Comment | PTSG_03507 | Salpingoeca rosetta conserved hypothetical protein (3176 aa)
Sequence
MPTVTRVRPMTHEWQARACRHRRALTPTFTAFIFIFILAACNLASTPVALGYECSQCPDG
RFVSQEACAAALQSNETTIVVDATSSTATITGNWAIVASPQPSSPEPPSNFLGAFYYSDD
DMGKGTKVITMVVSVFAPGTYSVALLHPLSIVAASRVPVRITSDASTETTLVYVDQREQT
SANFTDGVGGTLLSASLRATSYINVTVSTERTHLDNDNFFGSFVFVDGVFIQAATVDADC
SPCSTICSTTQFVAAPCTSSSDRVCSNITDCSLDMGLYQKVPPTLTSDAACANVSQCDPG
FFVSKEATRTTDIDCEPVTACNTTNTYEAVVATPTSNTMCRPYCHACAPNSETRYPCDDT
GASGALLANALTQTLASQDNTPPLPELANTASATFDITGPWVTITQNNVQYLSDNNDNKG
LVELRINVTVRPGLYKVSFSYAAMSVTASTRVPVSFTHATGNFSTRVDQSTIDPSGFHTL
GTFYIDDAGASFLIENRDSSNLGIDFGSAVTFRELRLDAAKLPIICQPCTQPPTCGEGQF
IGPECVCTAFSSCSSAQYEVAAPTLTTDRQCANLTTCASGEYEHTPPTPTSDRDCRPVLP
GCHDLTIQTMAPTPTSDRQCESLCAQCPDGSYRTQQCELYIAADAINATTTLDIDSTHIT
AVGPWVRVNEQAGDFASYLTDNDENKGDVYLNASAMLDPGVYDVEIAYKAQTNAATNVPI
TITTPFRTISLEIDQRTIPSSGWYTLSTITADALVPITFLIENRDTHINTENFFGNEVTF
AALRFVARHKQRTCSPCSECKPGFLVDQECTPTSDTTCRVGYNASALVHVSTSIGAFHVT
VDNGIIPTSPENHTDVHSKLTGTLRYGFPAGLAPGGSTSVSVELDQGEGAGAMAASLSAS
LGYSRGRAGASSVEAQLLTGEVWPDSRRVYVAVQVRDARGSTRTSSTTVHVRLVGGATLQ
QEVDTSMPSGTCSTDSGTGACIASVDVPEAWVTDAAAVDASQNGGGDDGSGALNVSVEYA
LTAGFQDAGRVSEVLLVRPESAFDPSGSNGLLIARVPQASLKSGDEFEVSLSVQAERAIN
TFRTSLFVGPELELVRFEVDEDVWTGQYGVTADGRNATGSYILRDPKTASQDAQTEEQAV
ATVVVRVRDGAGTSAAVQPLVSVRAVYLSDIDRRPLLVGGGAEPATVIVRRGGAYGSTDG
LARDGNGFVVVEPERVVGLVASAARAELVNTAVLSGSEETSALSVRAVSSWRPGQFAVVS
AGSPGLACMSLNTSVLLADADCGRVRVTGAESGGSPSVGVSVEYGGQSARVWVRVWYPEE
PVQVVLDRDVVRRVARWQRDAGHDASDGCVSLGTSQFQRARVSVVGRFRSGDAVSAALSL
GGLLGQSQLAVVNQSVARVDPVVSGHVQGVGAGQTVVRVLSAAVSGSRVIGEAMLEAQDS
YVGIVGLDVVVASAVRVSGGMSELGNDPGSSAEATVVVERDVLDFEGQRASVFVSAVFED
LTRMELGVGREVRLRTLAPGTVRVVGNGAEPGVIVVPGRAVDGSGELIEAIWQGGNANAE
CGVLEVVRGRGYVSVALPPADAARATVSASRLTFAGDAAETAGVATSAELTVELEYPDRV
VTATQDNRTLIDLSGAMGLVSLEEGGSTGLRLVANASKAGELGAGSVAVIRVSFMHENVS
ATVSVTVVAGVGVRADANPYPAYSGSSGVSVRTLHRLAGTTPAVYEALVVRAYLALSNGQ
EIEVSTAGALAVRQESAQLFEGGALVSDVSGQAVVDISRVTGSGSGTAQNHVSVGTSSAG
RAVLNGTNTSGSLVVQLRLEYASSVTSASQDLVVNVTREAAVVAALEGVSVAAGSTLRGS
VGAETTVDMRAVLDSGRVLPTLFSGGQALYPGLVVFSSSDLSGASIGARSGVVRLEGNAA
DVVTLTATVDDGRSGGSAVRGTVGVACNLDPEVGDADIGSASGVAVGPLRVGETVTVPVR
VNTGGAALGAYELAVMFDTTVLEFVSATASVNGLFDRNAQTAGRVEFGGTVSGDSVSGSA
LEVAELEFRVVGAGSSVLSGTVVTLSQPDVSGTAIGSGTERAFIAGRVPFEATSTRRRRS
SSSGSGSGSGKQGALLGATAVDEAVEAHAEARRRMRRNTGAPQRGDTNGDGVFGVSDVRF
VLTYLVEKELKFVSARGQAVLALHASKPYTYDELDADLNTERNEDDAAFLNRVNFGLLRF
VTGVGVQAVSSGTACELEVSAVLLDKGDGAASGADTRVYFDLEGGSVPAGLTSGESSLGL
ELSTSASVFSEGRFVTLSKGSGTLSGAIVEAELVNASVGLWRVSVPVSTVRTDIGLSVIQ
VTRDTPEALFVFMGGRTQGSKAYTGQVSVTLGAFGGDDVAVKTPVPQGYNPLQTFDNTVD
SVSCKLASGLCAVVPCPGGQVLDGVCTLSNNTYCRDYAIAAGSAVIVGDVVPQGSGAFAV
VGDGAGAGGNATMPTTSEDEWLASVGQSGGVVLSLDSPVTSGDTDASGTFRYGFPAGLAP
GGSTSVSVELDQGEGAGAMAASLSASLGYSRGRAGASSVEAQLLTGEVWPDSRRVYVAVQ
VRDARGSTRTSSTTVHVRLVGGATLQQEVDTSMPSGTCSTDSGTGACIASVDVPEAWVTD
AAAVDASQNGGGDDGSGALNVSVEYALTAGFQDAGRVSEVLLVRPESAFDPSGSNGLLIA
RVPQASLKSGDEFEVSLSVQAERAINTFRTSLFVGPELELVRFEVDEDVWTGQYGVTADG
RNATGSYILRDPKTASQDAQTEEQAVATVVVRVRDGAGTSAAVQPLVSVRAVYLSDIDRR
PLLVGGGAEPATVIVRRGGAYGSTDGLARDGNGFVVVEPERVVGLVASAARAELVNTAVL
SGSEETSALSVRAVSSWRPGQFAVVSAGSPGLACMSLNTSVLLADADCGRVRVTGAESGG
SPSVGVSVEYGGQSARVWVRVWYPEEPVQVVLDRDVVRRVARWQRDAGHDASDGCVSLGT
SQFQRARVSVVGRFRSGDAVSAALSLGGLLGQSQLAVVNQSVARVDPVVSGHVQGVGAGQ
TVVRVLSAAVSGSRVIGEAMLEAQDSYVGIVGLDVVVASAVRVSGGMSELGNDPGSSAEA
TVVVERDVLDFEGQRASVFVSAVFEDLTRMELGVGREVRLRTLARGDGAGCRQRG
Download sequence
Identical sequences PTSG_03507T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]