SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03555T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_03555T0
Domain Number 1 Region: 128-256
Classification Level Classification E-value
Superfamily C-type lectin-like 1.37e-29
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 2 Region: 31-126
Classification Level Classification E-value
Superfamily C-type lectin-like 6.01e-18
Family C-type lectin domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_03555T0
Sequence length 737
Comment | PTSG_03555 | Salpingoeca rosetta lung surfactant protein A (738 aa)
Sequence
MLLVLTTAAIVMAACVATAAPVDVATQAAAATTANDGYVEFSDVCEGRLFVGQFSFSSAQ
LVCSSLSYELATIEDATQNAAIASILEATGTAWIGGTRQAGDSDFQWVSGQPFQYTNYAT
GEPNSAAGWLQFDADTFFQAFVRRPQPFDVAQETCRAYGGELASIHSANENLFAATFLDS
DNSVQWLGGARSAEDPTVFEWIDGTAFDFQAWYPGEPNNYRGNEACLSQGLKLVQSSQWN
DAPCSQSRPFLCKSSTPQQFPALVLEFPTPISESDVPAIELLLQSAGLPSNNPTGSSITV
QLLSSQLVYIQLAGNFEQYAGELALKALNDQLIWQAGIPIAYGQCSVFMDQCGEYELAYA
TDQPNSQQLQWRNAFYPPAFAREPLTAIPEETTLAAFEAECRCACEEVADCVALYVAVGT
TQYACTFLATTGGAQHTTNEGRSYMKIYGMTEFPAIPDALQACLTTTSSTSTATPLAGDY
LSLFRGRFVFDGFRFANAFSDTNTIRRMYFDIEASQDLVLSRCSTSCWTTPECTGFYAHF
EDTRVFCNLLDAPRGKAKAGQPSASFILPRSLRLAPRTTLSPIDDTTTTTTTTPTTTTTT
TTTTTTTTTTATTTTTTTTTTTTTTTTTTTTTTTTTGTVGPCQLQTVLTCYYRDSGSCSN
DGSTNVTPSQVPRTRSIPLCSLEESLTCYYRDAACEVDNACVLDATSGFCIPHPDTCTLE
LQAQRPVAPSTTVGDTE
Download sequence
Identical sequences PTSG_03555T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]