SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03594T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_03594T0
Domain Number 1 Region: 130-459
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.78e-61
Family Putative alpha-L-fucosidase, catalytic domain 0.0075
Further Details:      
 
Weak hits

Sequence:  PTSG_03594T0
Domain Number - Region: 66-98
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00169
Family Hairpin loop containing domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_03594T0
Sequence length 573
Comment | PTSG_03594 | Salpingoeca rosetta conserved hypothetical protein (574 aa)
Sequence
MKYAALLLFLAALELVVVVCGGAGALHAAVPALNGVGVPTCEKNTTVDPSSITRIGADFQ
WLALSDSATLQDCIRACCNNNLCQAFSYNTKVKYCTRAPGGPNKCCALKSSIPKAQKSSF
PPGEVTTGYRYEPPATIPRPSKRQQEYMDMGLTQFMHFSVTTFGNIEHDCVDGSCLPPSL
FNPTHMGPDAHGITATDQWVQAAKAMGAGEICLTAHHEGGFCLWPSKFSNYTVMQSPHKH
DIVEAFVKSCRKYDVRPCFYIGPNANGYFTQVLNYTTEQFVTAQLGMIREVLTKYGFISR
LWWDHYLDACGGLSECPACRNQSDPTCFPAAWHTFASLVRELSPNTLIGTGPDVSHSGGG
ETGVGDYPVWNAANATHSGFGPFGRLFLPREADATIQNPGDAWFWKKDHAYWNATTLWNH
YLLTVGRGENFILNLPPDTTGRIPDEYVRVVSAFGDAVRATFSSPLGSIENVTVTCDYPI
VVHMNESAATVDMVETREDLMSGQTIAKYAIDALVNNQWVAQTVHGETVGNRIVDAFAQP
VVTSTLRFRCLDAVRETIHIRSIKAFKSAPPAA
Download sequence
Identical sequences F2U618
PTSG_03594T0 XP_004995324.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]