SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03605T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_03605T0
Domain Number - Region: 105-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000605
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 150-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00152
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_03605T0
Sequence length 364
Comment | PTSG_03605 | Salpingoeca rosetta predicted protein (365 aa)
Sequence
MTITVGGQCFPYFTDADECDMWARTLGFRAQLTEAGCATSNGIISPSFNTEDDCLAAATA
IADATSCGDATPMCFFADPDYLLQADESNCSCLLEIAQELECFAFPCLRDPCKNGATCVT
NTSCVDDVTNTYCFECECTDEFTGRFCDQDANPCDTDNGGCDDTCVDGVGAHYCRCNNRP
LATAGMGDCASFCDWTWSLFEDRVLRCLDFVTAPVGTPLSGIGDVAVQPPTSTAVAVRSS
ASLDRNRYLSFEDACGDGVRLSGPFDCTGGCYVSFDFWFDDDNDADTHLTVTARASDGSA
IATATSDKGGGETAFGDVAHTSGTWRRVVLPLITGDVARLVFQVDEASTCNANYRVDDVL
VAMA
Download sequence
Identical sequences F2U628
PTSG_03605T0 XP_004995333.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]