SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03655T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_03655T0
Domain Number 1 Region: 388-548
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000299
Family Leech intramolecular trans-sialidase, N-terminal domain 0.033
Further Details:      
 
Domain Number 2 Region: 616-665
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000131
Family TSP-1 type 1 repeat 0.0074
Further Details:      
 
Domain Number 3 Region: 224-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000142
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 569-622
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000251
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 298-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000402
Family EGF-type module 0.011
Further Details:      
 
Domain Number 6 Region: 268-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000015
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  PTSG_03655T0
Domain Number - Region: 191-233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00305
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_03655T0
Sequence length 1976
Comment | PTSG_03655 | Salpingoeca rosetta tamm-Horsfall protein (1977 aa)
Sequence
MPLPMAVLALAMLVATCASSAKAAECQQPWTLLVRHDARAGVFPKGELDVNANDDSSLIY
ASLTALESQRSFDGNFYFKLVWNDLCESGCLSNKTAIIWSQTSNPTTSNNVTGYMPFDVA
PYVSFEGMKLGSYALFDGQSGFSFWYSVGMFELFNEEIPGPIPPGHLQGMTTPRVELYVK
RLDSGSIAVDGPCPEFATCTDIGEGNHTCACPSGFEDTLPSACVDINECETTTKCHADAT
CVNTPGSFACVCNDGFYGDGTTCEPNECLEQGICHEHATCSKTTGDYTCTCNDGFVGNGT
YCADENECHSDPCLADAVCVNTYGSFHCVCRNGLDGDGITTCQDDLVVWLEGSDYVHGAD
MWLDRSGDNNHAFINASAVMFDASRGHFIFNGTMEELITVDLDIGPNTFPSLTIEVLFLP
ITAVGDGAVIDADNGGYDRHLDFNDYELYGPGIASGTGSPYEAGSTAIFHRCWQHAFAVF
EQSGRRASFTVRNGHVGRPTTALNTEGYTNFTIGGSRWDGGALNGYVRRVKVYNRALTEE
EIQIKYDETKPDLFCECLPGYRGVEETGCIDIDECVEQTDTCNPLRGVCTNVPGSYNCTC
AEGFFGDGRTCDPPAPCVVSDWEVTEECSAFCGIGTRTETRDILRMPVDGGASCPSQLTR
QTPCIVASCPSSTSIDFVITTSTDTYNASSGTPFPALDTALGNLGSGTTSAITGVVVDEA
TGTVLVQVAVDTPDSSAASVRSALNGLASADVAVDSQDIGACYCSAREEDGVTWLGAACG
QLSPTVHTCAGSTTTFITRNCTGRIADGGWDHPDTTQCVNEDLAALADSLATTPISDVLA
QALLHTGSPQLFGVQDVANLERILNATIYMQANNITDLAVDDVFAFVRLLSRTIGAPEDV
VTAGLSTFGALTGTSLIPDAEEMLLYFAEHVLPLDESISAVEANVAVDLYHTSFNPTAQV
SWPPQDSRASITRRCYGPEPEHYCYVNEYGSDAAAFDADLSITVPETLLNLSMTAPLASS
PSSSSLSLSSNASSNATASGGTGEDATRPLLAIVGAYATKFLFPSISLRNTMSQLVYATL
PTLPDDYNISSDPLRFTATPQFYNGTDTGCAIWTPGSWDPTVCTLVNPDATTGAYACECE
HLTTFGLIELREPQPSFVQPVYEDYVRGCASLACLFLVITFVVHFVQPSKWSPSRMVVMH
QCALLVAALIIFMVGFYDIRNPNCREIAVAQHAIAVAFFAWILAGAVLSVFRKARAWQLL
IIGYVFPAIVVVVTAVLRYDDYGRKRYRTDPDKHCFIDTDIDLIWAMYGPAAGFAGVAVL
IYLGIMCFSVCFWPKDRLKMVVGVTSVTGTLKRRRKQASISNGAGEEIELDALSTGTDTM
SKNATSTSALQEQEKPEHRDIEPVSRGHALWMSFASFLLAGVGGGIPLAELFLINGVYTD
LWRPLFAGGVIFYGALMLLVFGLPDLLACLCGRRRSSVTADEEVIAGDANKRVAEWDEFG
RQSSARRRSRRRNEATLRYLRTLPPAEPKRKPLPQVQEEQQQQQEKDAMSAVSVPSTATG
AAASGMVDLSVTQFDTASLNLEGDMDAPLQPGVPDPFVVDRDVFDVLEADMVKLREELAD
LADESELEEFDAILQDMDTAHQESLQRQLYNRRKSMRRRASSSSQMGMLSTASVRGSEAD
FMMSDNDSISTAGVIPRNSSTRRSSDSSLEMDFAFERQSSSVRSEQRRPSAEYLQTDGLS
RGTSIRSVRSSGSQMVTGAMSDASQPSVHSSQRGALAAIVEAGQERDDLGDGDGDAANNT
NGDANNGNTGGDARGRDSTMTTTAAREAMMAERLKDFADESEGEGGHNMSEAEDGDNDDD
EEQEEEQVLVGADDDGDGDVGAVGASLEDSYDNSDFVGTGAADDVYADPNAPDESAGEKR
VSLTPDEEFSEMAGLLATLQDKVDRPSLPSVQENAEEEEDDDDEGGDGDGPTVSYF
Download sequence
Identical sequences PTSG_03655T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]