SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03763T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_03763T0
Domain Number 1 Region: 138-230
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-21
Family PDZ domain 0.0068
Further Details:      
 
Weak hits

Sequence:  PTSG_03763T0
Domain Number - Region: 18-86
Classification Level Classification E-value
Superfamily Tropomyosin 0.0386
Family Tropomyosin 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_03763T0
Sequence length 248
Comment | PTSG_03763 | Salpingoeca rosetta predicted protein (249 aa)
Sequence
MGGGSSRQLDELDVAIFNLKQTSESFRERATGAIDMMSNRLDDLEKRVTLLVRQVRGDPM
ETDDSTSKYADALHQLTSHDDVLQSAMYEAQGMRYNSTRSQHHPHHHNGAQQQPEAAEDA
EDYQFFRKDSFRVEIFSKRHDVTLRREPTESFGLTIVAAQSASRSGNPVKDHAIFIKAIK
PGAVADRDGRLRPHDRVLAINGIDVSRATHEQVMGLVSASGREVTLTVAALVKVKRRRKP
NDAKASRR
Download sequence
Identical sequences F2U5B0
PTSG_03763T0 XP_004995490.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]