SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03917T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_03917T0
Domain Number 1 Region: 243-584
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.48e-96
Family beta-N-acetylhexosaminidase catalytic domain 0.000000351
Further Details:      
 
Domain Number 2 Region: 109-242
Classification Level Classification E-value
Superfamily beta-N-acetylhexosaminidase-like domain 1.57e-26
Family beta-N-acetylhexosaminidase domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_03917T0
Sequence length 603
Comment | PTSG_03917 | Salpingoeca rosetta conserved hypothetical protein (604 aa)
Sequence
MVRLVQWVVAAVVAVSVAATAVQGDGALHDPAWRRVNQSDCPYDDTGDSCTGATVEGCKV
KCAADPACGGFNYPHGIMKKTDCSAHISTSPTVDLYLLVKDISVNWPPIWPMPKSYTNGT
TNLKVDGSKFGFFTTTPSADLTAAFSRFRPLFFPHRTSASPAGATRGVDVTVHNSSVPLQ
LYADESYTLSVPADGGNISLTANTVYGAYHGLQTLSQLISFDFTQQEYVIPGAPWKISDA
PRFPHREVLIDSSRHFEPVETIKDVITSLTYAKINTVHWHLVDSQSFPFISPTYPDLAGK
GSYSLQERYTVDDVADVVEFARQRGVRVVVEIDTPGHAASWCAGHPEICPSAQCQEPLNP
ATNTTFNLIAGLFKDLTGGARGSGLFPDNLMHLGGDEVNTKCWSESPTISKWMQDHGLTP
DGAYAYFVNRTQAIARGYGRDVIGWEEIWDHFGTSLDKSTIIHQWLPKSSIAINATKAGY
RVLWSTDGAWYLDGLSVTWQEMYEQEPCTGIDDHLCDTLVLGGGGCMWGETVDTSDIQQT
IWPRMAAIAERLWSPRSVISAAQADARFRSFRCLLNRRGIAAAPANNPTAREAPPHPGGC
LEQ
Download sequence
Identical sequences F2U791
PTSG_03917T0 XP_004994812.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]