SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03928T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_03928T0
Domain Number 1 Region: 112-266
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.8e-43
Family Hypothetical protein AT3g04780/F7O18 27 0.00013
Further Details:      
 
Domain Number 2 Region: 2-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.38e-30
Family Thioltransferase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_03928T0
Sequence length 289
Comment | PTSG_03928 | Salpingoeca rosetta hypothetical protein (290 aa)
Sequence
MPVTTFSTDAEFFDAVKASTQKVIVIDFFAEWCGPCRQIAPFFSSLSDKYPDAAFFKVDV
DKLKEVKRVYNVSSMPTFKFVQGTQVVESFSGADPERLEQTLKRLLSESGGAESDSVVRG
QWVLNKFVNKAQMECLNQNDDHPLEHALTDDEDTFLESDCDEQLMIALNFTLPVKLHSMR
VVAPTDGRAPLTIKLFQNRTTSLDFDDAEKIEPVQTLTLTESQIQGEPIELRFVKLQNVN
SVTLFVVDNHGGEDTTAINYIELIGTPRDTTNMAEFKRVAGKPGERDAH
Download sequence
Identical sequences F2U7A3
XP_004994824.1.12839 PTSG_03928T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]