SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03946T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_03946T0
Domain Number - Region: 149-181,220-373
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.00955
Family beta-glycanases 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_03946T0
Sequence length 820
Comment | PTSG_03946 | Salpingoeca rosetta lysosomal alpha-N-acetyl glucosaminidase (821 aa)
Sequence
MMMMRVVAVAALVLASVVVGVLGAPPKVSLSAPVHDAVAGAEGVARRVLGEEVALNIVFQ
EIPPNVADGHDVFEIETVDGQLVIRGNTAVAMSSGLYWYLRYYCNSQVTWGVNDSGRQIN
VSAQLPVVKPMVRKVNQVRFRYYMNVCTVSYSMAWWNWTRWEKELDWMALHGVNLPLAFT
GQEYIWYEFYSSLGLTDSEILDYFTGPAFLAWQRMGNLKYWAAPLDKDWRTSQYNLQLKI
LSRARELGMVSALPGFAGHVPTAIKRIFPHANLTQTAGWANFNSTYSDVSLLQPTDPLFL
QLGTKFYKMLIKAFGTDHVFQMDTYNEMQPSFTNMTLLAESNRVVYQAMANADPEAVYLM
QGWLFHESYWTPEHVKVYLSGVPDDKMIILDLNTEANPVFSLTSDYFGKLWIWNMLLNYG
GRRGLYGNATDISTRPLLDLHRAQGTMDGIGITPEAIENNPVMFELMLEMGWHATPPDMH
DWIAAYASSRYGKRESLTQSAWQLLLEHVYDQPDIDRFHMEMVPDLSSSESRNSNTTALV
QAWRLLVTAAVNGSLPITGPFSYDLVDVGRQALLNLWSDVRGMLVAHVKEYNANIDSSPS
TAASHVPAIKSLFTLLLDITSDLDRLLGTDVNYLLGVWLESAKATAANADERATREFNAR
NQITLWGPDGEITDYAAKQWQGLVSDYYVKRWEMMHDATLSALNSSTKIDTSAPKDTLKF
EQAWGNENKTYPTAPQADVVKVSAAMLQKYASSSSNYTVSTGFDVPFKDIYQGWTRDVAQ
LQILCDADPTCVGFNSNGYLKNSLTPSKSSPGTKFYIKNT
Download sequence
Identical sequences F2U7C1
PTSG_03946T0 XP_004994842.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]