SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03992T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_03992T0
Domain Number 1 Region: 23-77
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000791
Family Complement control module/SCR domain 0.0092
Further Details:      
 
Weak hits

Sequence:  PTSG_03992T0
Domain Number - Region: 94-136
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000848
Family Complement control module/SCR domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_03992T0
Sequence length 137
Comment | PTSG_03992 | Salpingoeca rosetta predicted protein (138 aa)
Sequence
MGCAVQDGGACDAASLVASFGAVPSHVVHNCNNVALGATCIASCDVSGSYTGTPQTLVCG
SNSTFQGSLPTCFAPCNPAEDESAIVSHGCRSLVPVGDACTWECARGYAGADVTRTCTAL
NANTTAFDAPPPSCTRE
Download sequence
Identical sequences PTSG_03992T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]