SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03993T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_03993T0
Domain Number 1 Region: 220-263
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000353
Family TNF receptor-like 0.0049
Further Details:      
 
Weak hits

Sequence:  PTSG_03993T0
Domain Number - Region: 268-303
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00801
Family TNF receptor-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_03993T0
Sequence length 462
Comment | PTSG_03993 | Salpingoeca rosetta predicted protein (463 aa)
Sequence
MDLSDCFGAVHTNSCVIPCAVGYAGATAALTCDNGQFIGTLPMCTPKQPKLVTEGGTLRV
EVFDDKRMDLAYMTQNLQPNAWSGRILSDVEIEASITSTLSTIMEDGSARVRTEAKVAQI
VAANVLDSQGVVRAAVQDAIDANAPQGSTLTEYLGEEFDRVDGRIDSLQTYVDEQDDGVL
STLRDELASTVSAASDALSAELDGVTSAIDRMAPAIAAAERCLKFCPAGEFMNRACTPTE
ANQCQQCPAFTYSATPNMERKCQDCTPTHCNAGSYMVPCDRTVGDSSCVTCPSGKYQDAS
QHRESSCKTCGCPGGTYPLTPTCPGTSNFECLPGGIKVVGYSSCSAGQWKMTGAEGGCRG
GGAYQNTQLTGGDHGSNYDVRATSTVKFAAGRYRFYCAADDCCRIHLSGPRTFYAIDHGC
GGCTSCNGHTHDHDIPAGVYTVEYYMHEFSGGAWYDFRVYRL
Download sequence
Identical sequences PTSG_03993T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]