SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04006T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_04006T0
Domain Number - Region: 119-168
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000347
Family Complement control module/SCR domain 0.0057
Further Details:      
 
Domain Number - Region: 48-102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0005
Family Complement control module/SCR domain 0.0092
Further Details:      
 
Domain Number - Region: 157-219
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00403
Family Complement control module/SCR domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_04006T0
Sequence length 417
Comment | PTSG_04006 | Salpingoeca rosetta predicted protein (418 aa)
Sequence
MASKHRVCGPWLALVVCAQLLAVAQMGCAVQDGGACDAASLVASFGAVPSHVVHNCNNVA
LGATCIASCDVSGSYTGTPQTLVCGSNSTFQGSLPTCFAPCNPAEDESAIVSHGCRSLVP
VGDACTWGCARGYAGADVTRTCTALNANTTAFDAPPPSCTPVPCSLPAEADPQAMDLSDC
FGAVHTNSCVIPCAVGYAGATAALTCDNGQFIGTLPMCTRTYTDSAVGLNSPKLVTEGGT
LRVEVFDDKRMDLAYMTQNLQPNAWSGRILSDVEIEASITSTLSTIMEDGSARVRTEAKV
AQIVAANVLDSQGVVRAAVQDAIDANAPQGSTLTEYLGEEFDRVDGRIDSLQTYVDGQDD
GVLSTLRDELESTVSAASDALSAELDGVTSAIDRMAPAIAAAERCLKFCPAGRGHWS
Download sequence
Identical sequences PTSG_04006T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]