SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04060T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04060T0
Domain Number 1 Region: 30-266
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 5.63e-23
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_04060T0
Sequence length 269
Comment | PTSG_04060 | Salpingoeca rosetta predicted protein (270 aa)
Sequence
MAVLLVVALSLLLPVGAGEASNDVQGVDAATWATPPVHHEPLYSSRCNIPKLYTKEEWEA
YQAQGRTDPVILVGFKDNSYFQSVCTKQNLLQQYGNTSVVLSSANTHSYKKNTLVFREYL
EHLVRPRTMDDVAGDTWYFFGNNDYDKSWTNFTQHYHRPDYTYTREPFFSFGIGGSGSGV
PFHTHGAVFAEVLHGAKRWFLAPPEVTPRFSPDETSYRWLHLVWPTYSQQEKDLILECTL
YPNEVLWIDAQWWHMTLNIGDTVFISTFI
Download sequence
Identical sequences PTSG_04060T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]