SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04123T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_04123T0
Domain Number - Region: 304-545
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.00432
Family Amylase, catalytic domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_04123T0
Sequence length 784
Comment | PTSG_04123 | Salpingoeca rosetta predicted protein (785 aa)
Sequence
MTHHRSLLLAVVVVVVCSGHLGGVHAQLGLHLNGDGSYDVRVRGNTWLTSADTAFYVNDE
WLSIHNFRLALTKNTTTRGANSYGSFTEYTNTWKAASQVHFGFEVETAFKVYENGNRIMF
TQRWVSGGKNTSAGTTDNVLSSFPSFNLSHTPPSSLHLGCAGWFGTFIDDSHRGPAIGKW
PDGTVGGKDFGPMVLFDRDTDDAVVFAAASEFMAASVEKTDNALRAGILGSVEEVPAGFS
VAFSLTLNTTGVNNAMTSWGRALRRHYNKSSAPAQCDLTLQYLGYNTDHGAYYYYNPQSP
NFNETLVGVFESAKQQSIPYRWILLDSWWYFKGTGNGVKNWTAMPQIFPPGGTDGLAEFT
SITQWPVIGHNRYWSNNTDYAIQNGGKFAFSDNKYAMVVPLEQAFWDFLLGSSKKWGLAV
YEQDWLYNEFNGVPLLTKNISMARTWLMQMGNAAAKHNLTIQYCMPYPRHALQSVEISPV
TQIRASDDYVPGAAGPDQWRLGSSSILAHALGLAPFKIQPSWPHDNFWTTPRQPNASTGP
LGHDDAVWREAAVATLSAGPVTPADGIPYQNKELIMRSCNEDGLLLNPDRPAVSIDQTFK
AAAFGAAFGAAGQLWATYSTIGSHRFNHVFAAEMKNTFDLLPSTLTVDATATATATEGMV
AYAVANTTSLDVSTLRVQQFSREVPIVISAQTSTPNTFDLYHTAPVFDNGIAFLGELSKW
VPTSSKRFKGFTKTASSIKVEVVGALGEKVTAHFAYMSSSTNDITIKHASCVISGGTSCH
IESP
Download sequence
Identical sequences PTSG_04123T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]