SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04146T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04146T0
Domain Number 1 Region: 328-458
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.35e-19
Family Growth factor receptor domain 0.00064
Further Details:      
 
Domain Number 2 Region: 843-1005
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.27e-18
Family Growth factor receptor domain 0.00023
Further Details:      
 
Domain Number 3 Region: 667-789
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.09e-18
Family Growth factor receptor domain 0.00034
Further Details:      
 
Domain Number 4 Region: 535-654
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.09e-17
Family Growth factor receptor domain 0.00057
Further Details:      
 
Domain Number 5 Region: 453-576
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000357
Family Growth factor receptor domain 0.00023
Further Details:      
 
Domain Number 6 Region: 978-1140
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000236
Family Growth factor receptor domain 0.00032
Further Details:      
 
Domain Number 7 Region: 209-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.0081
Further Details:      
 
Domain Number 8 Region: 96-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Laminin-type module 0.071
Further Details:      
 
Domain Number 9 Region: 156-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000112
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 10 Region: 260-306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000594
Family Laminin-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_04146T0
Sequence length 1316
Comment | PTSG_04146 | Salpingoeca rosetta laminin alpha 5 chain (1317 aa)
Sequence
MLAPKVTEEAVCVSTGSSPAGDNDLQFNPLDPQRPPTGSSRDFFNNPRLQAFVRTRFLRI
AFLEYHGPDTAEDPFGNPLPDIPFYEITSIRVSSRCFCNGHASTCQTNMDEDGAEFITCD
CEHNTVGATCDQCLPLFNQHAFMQGTPSAANECTECNCNSHADACAFTPDEGVGVCIECK
DNTTGIECEACTENHYRTTTNLTASCVDCACDVDGAVSPQCDVRTGACVCKPRVVGRACD
TCEPGSFGFGRDFFYGCLDCACSDIGSESGVCDSESGQCPCKPGVSGRACDRCGVGFYQS
GEPGQCSPCHEQCGDEGCAAAGALLGFACRSCRNVVADGTCVASCPPNHWSDDGVCRPCD
QQCSGGCTGQGPSACMSCVNVELDGTCVPNCPTATFVDDQRRCIACDSQCDSRGCVGPSA
SECRACRRFSLNGTCMNDCPAGTTSVAGGDCQPCHHQCADGCTGVTAFDCVACRTFSRVL
NTGAVECIDACDTFEYSTADSVCAPCHAECQLGCTGPSASECLDNACRRFSLQDGECVAT
CPSNTYADDEGVCRPCSSLCNGACWGPGDHQCLSCADSAVAIVQAQAGVVHVTCADTCPD
GTYEDDTRVCRTCDAACATCSGPSSTSCGSCVAFADTTTSTCVSSCPHDAYASPTAPVGF
GTTAPEYCMPCNAMCDGCFGPSNADCAACRGVVADGRCVSSCPNGTYLQDSTCWPCSEQC
SGGCRGPGAADCISCAGVLGSDGVCRNECFAWEYADEDGICRPCHSLCSTVVQGCSGPSP
DDCTECAGVLVPTSALQTGQENNGSTSTSTASTGTTVTSASTTTACRAACPHGFFADADT
STCTPCHDACDGCTGPDASDCAACATARYGGVCVLECPTSTFLSTSGTCAVCNAQCSQSA
RCSGPTAFDCLPADGQPVMANPCANVRHEGACVSACPAGFFADNNRECAACHRSCAACSG
AGEMDCTSCRRGSHLTASGECDDCNPLCRDGLCSGPTAADCDAGCLAVTDLSDPQTPVCL
VACPVGTFSDTTPVDGACNLCHTQCAGGCTGVTAFDCVACANVENEGRCVSACPDGSAPS
EAGVCGRCHDECIDGCERPGDASACVRCRNKEEDGACVVQCSTGFPFLAGDACLAACPGD
QPFYNDTRQSATFLPARCVTSCAQLGDARRTYVSEAAPFRCTTEDQARRDTRALSSASSS
GNEATTNILIVVVCVVAFLMLVVVMLFLRRARQTSHTGDAAISSPVTLTSRTDSKSSFGA
AQPGAHQWNPQWAAENDMLRQAPLVVPGNGGGGDDDDDGGYLTVEPIPQPTHSTHV
Download sequence
Identical sequences PTSG_04146T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]