SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04159T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04159T0
Domain Number 1 Region: 31-99
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000218
Family PLC-like (P variant) 0.054
Further Details:      
 
Domain Number 2 Region: 424-481
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000262
Family EGF-type module 0.021
Further Details:      
 
Domain Number 3 Region: 468-526
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000785
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  PTSG_04159T0
Domain Number - Region: 559-610
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000115
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 331-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00135
Family EGF-type module 0.0094
Further Details:      
 
Domain Number - Region: 241-293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00726
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 149-202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 618-664
Classification Level Classification E-value
Superfamily MetI-like 0.0883
Family MetI-like 0.012
Further Details:      
 
Domain Number - Region: 207-255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0967
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_04159T0
Sequence length 799
Comment | PTSG_04159 | Salpingoeca rosetta hypothetical protein (800 aa)
Sequence
MKLLLLPLAIAFIATCSTLVRAGKVSVLVKGGKVKDRDGWPRGESDPVVEVRVPGYAGWM
HTTEDEDDNSPAWHETLEFPNTDIPSTFSVELHAFDLDGFLYVNEWGDTDDLGRDTDSFT
FDGCDPVSRDHRFDLDGDNKYIDVTINYTPTDLCLSNNGDCGPAQSTSCTCVRDEEVQCQ
CLDGFKSDTGKDCFPIDPCQTSTFGGCDKQHGVCTYLGPGESKCACKGGYRFASTSDHSN
CDPINPCEDVPGRCGENSLCVYDGPDKFHCTCVEGYESANAENTDCRPINPCEKEGYGGC
DANTQLCRFMGPNTNECDCKPGFDGADGGSCDVVNPCEDTPTLCGDNSTCIYTGPGTSRC
ECLPGYHAPHNPNNTDCQPVNPCVTHDGTPTDICGVHSTCSFTGPGQHECTCDDGYESST
GAACTPINPCETDNGGCIFATCVYRGPGQHTCECLPGYDKLSPNSVECTPINPCKEDNGQ
CGPASTTLCIHTGPEMRNCTCHEGYTSTTGRNCFPINPCVTDNGGCGFENSTRCLFDGPD
LASCVCRSGFAGDPPNTPCEPVDPCSIDNVCGANAECTRTGLHTYNCSCIAGHVSDNGGR
NCTPSSSFLASTGSMTTTLDPAASQSTATSISAATWGGIAAGAVVLVVIIVVVVLAVRRS
HDRKVLDRHASGPSTSVVNPVYQGPPAMAPVQPEYSALDESGRGRSYSAHAADPMVYSHL
SRNGSGSGSATIVGVPTYASPTVQLNDESDAYDVPRKEPANAARAGRLAANSGYAEPPPR
RLLANTAYEDHTLSRHADA
Download sequence
Identical sequences F2U6S2
PTSG_04159T0 XP_004995058.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]