SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04263T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04263T0
Domain Number 1 Region: 951-1244
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.32e-70
Family Protein kinases, catalytic subunit 0.00000175
Further Details:      
 
Domain Number 2 Region: 579-750
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.18e-20
Family Growth factor receptor domain 0.0019
Further Details:      
 
Domain Number 3 Region: 55-182,267-282
Classification Level Classification E-value
Superfamily L domain-like 3.12e-16
Family L domain 0.007
Further Details:      
 
Domain Number 4 Region: 398-540,583-599
Classification Level Classification E-value
Superfamily L domain-like 0.000000147
Family L domain 0.02
Further Details:      
 
Domain Number 5 Region: 237-375
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000335
Family Growth factor receptor domain 0.0013
Further Details:      
 
Weak hits

Sequence:  PTSG_04263T0
Domain Number - Region: 849-886
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00285
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_04263T0
Sequence length 1459
Comment | PTSG_04263 | Salpingoeca rosetta receptor tyrosine kinase proto-oncogene (1460 aa)
Sequence
MARPAALALCAMAVVLVGIGSVGTAVAATAEASFVKGKSASPACLPGRPLVISQTTSVSD
VELLANTTIFDGSLEFTADLCGHADFSGIVAQLQASLSDLTEIRGYLVVHDASCFTDLSF
FGSLGVVRGRYLYNDEYAISVDVSADNGASPPFTALSLTSLQTVERGSVRFTRDASLSTT
CLGFGTASQAAQEGANFTALLSGPVSAPQTSSGVVTIDVGDWSVVFTEDTACGGPFCNAA
CDACWDAAPSSCQAVCDAGACGAAGCHATAATCCPSTCAGGCFDASGSTQCYACAANHLR
TATGACVPTCPASTMAAGFEAVAVANCTSDPVSGAVTYEDAFFYCTPACDRRTALFAGEC
RVRCPSGYAAVDGQCTPAPDYTVCTSVYDLTHVCQLSALQQEDCDYLPGSVHLRPYGSNV
ESSLALAPESLISQATTKLRRVGGELSVHRVLLETVSILENVQRFDANVYGTLDLNDQGL
WLSSLAPPTDVISVHTNYFLGTLGLRWLRSLPQDSNVHFVDNYLLVLHNTVRWADVNATA
TIEILGLLDPSVNGIFFSIFGLLISSFQSAGNLHPIRKEVVQCAQHCGGACWGPGDRDCQ
KPPLGKLLFNGTLIDDTYGCPNGTYEDELVCLECNAQCATCSGPDDDQCTSCDGGLVLQD
SMCLDACSDGWFPVSSVCVQCDPESLHIVQECEMCARCNALGCIECNDDFYVVEGTSAPV
LCVDTCTNGTYTNPTAGTCVQCPDDCFSCSSDSCDLCNDGFYRADVGGVGTCMPLTTCSA
AQFEMVPATALSDRECMQLSTCGSNEYIAVGATPTSDRVCQQCQQCDPATQVRVGGTCTG
TIPGECVFIDLCTASTCKNGGQCTSINGTQIECTCTADFCGTVCSSPVIDGKCQLGESSS
SASSVVAGAGVGAGLLLLIVLLVALFILRKEGRRALDVYIPSKELRERTKPDEWELDRNL
LTVGRVIGEGHFGKVSHGLLAHSDDKGTMGNSVPAKEVAVKQLKGNANGTQEEDDFFKEM
ELMKSLGRHRHVLSLVGVCSIDDPILLVIEYAEHGDLRSFVQSKRATERRGPLLNNTHFV
DFGAQIASGMAFLEHNRIVHRDLAARNILVSSGTVLKVSDFGLAREIDSDEEYITQGEGK
MAFKWMAPECLRLGVFTAKSDVWSFGVTLWEIANFGGMPFPLVGNDKVLEELDRGLRLQQ
PDECSDALYAVMNACWLDEENARPAFQELLVRLAKLSQHDITYYQDPNAGQRPDHMPAEV
FERLVAQGRLRPVSNDYTTAADGRGAGGGDEDDEDEEERFPTYDNEAVTMTPDELDEQDR
RNTLMAQQRGMEEVADGAAYDLGAADNEGGTAEDEMDQAAYDLGDDAANGGAGESMTEEE
MDQAAYDMGDADEDTAAAPAMTEEEMDQAAYDMGNESEEGGSDSEDEDDDDDDDDDDDDD
DDEEEEEEPHGFSENPLVK
Download sequence
Identical sequences PTSG_04263T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]