SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04308T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04308T0
Domain Number 1 Region: 37-297
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.26e-21
Family NagZ-like 0.013
Further Details:      
 
Weak hits

Sequence:  PTSG_04308T0
Domain Number - Region: 353-392
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00122
Family TNF receptor-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_04308T0
Sequence length 1108
Comment | PTSG_04308 | Salpingoeca rosetta predicted protein (1109 aa)
Sequence
MHGGVHRDVRSSQSHEHQSGQTIPANPFPTATKELPFCANTSLSIGARLHDLIGRLSLQE
KAGLIGPDPVTSPCAFLGDGVKRLDIPPYLYLVETNTAVAAACISQDKCATTFIGPTGSW
RSLQPRVISTEMHAFNNLNWHRRGGVLQKIGLADPFLSGEDAAAYLAGCQNGPDRKYKKM
AAGLRHIDAYSVETNRMAFNRNISTFDLWDTELQARALTAMCSYPNINGVPSPCANNMLL
NDVVRRQWKRDMTLNGGADMELGEAYFTTNGYLEQAVKHNRTTSDTVNNNAVRRTSMSAR
SADSSLTSSNGRCISECPDDGEYELSNGCAKCHSTRCHQLPPVRRQTHQSRIADCPLNYY
AKDHRCVPCTRCGMGTWASTPCSLSSDTVCSPWTEYKPGQKESVSDNAVRDRACVSCTLC
VCEEPFIETIPPTLTTDRLCSCDTLTCNKLVTQLFEEMVRAEHTDEQLDVVLDVCSSDPG
EDGIRDTIRQKARRPCPGCTDTCECSAGFILVYDADPADRRPCDSVTEFSPSIGGSKCEL
IEECERGQEEVSAPTCCSSDRVCHDCSAGTIDEDSDASPAAPAHDHHDSDPATVDEACRS
VMQCDPDEEEIRYANPHASTTASAAKCVQDTCVPVSRCAASEYISTHGREQAPTLDSDSE
CTECSECPSGRFEIRACSALEDVQCAGCSACPPTTYILRACDSGDRCVVPAYCSAPCTAI
SDTECTTLGVCHQDQFELFPTATPTTDRICRDLTQCNPSTEYERTACATSSPSATLCEPC
PIGTIDHDRNPLTACLPCPYGYYVPEGSSGSCEQFLCPAGTPDLDRNPSTRRVGVDFAAL
SGQRDCTPVPECDLGYEEVVRPTMRPTIFTDRQCHRCIEGWFCHHSNTDVCTRVSPCEPR
SFETAAPTISTDRECQMGHTCPNNTTFISRLLTPTTQNHRHLLAYELVAPSLVNDRECQR
VRSCQSTECERRSLKRSHPACVPAYSVSLDFDAKFNAHAGTQSGREAFEAALGSIIATVA
SLNEDLTARLFNRSVSGDITVMGFTASKCKADETTTAATIIAPVVIECCQYTPPSPPTSS
SSSQHCCHHHEQRQQPRMAVLHLYLCVS
Download sequence
Identical sequences F2U864
XP_004994395.1.12839 PTSG_04308T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]