SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04356T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04356T0
Domain Number 1 Region: 25-171
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.36e-38
Family APC10-like 0.0000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_04356T0
Sequence length 198
Comment | PTSG_04356 | Salpingoeca rosetta predicted protein (199 aa)
Sequence
MSDEDESVEGVGEEEEEEEMSEDCQYMDEGDLPRDIGDSGVWTLSSCKAGFGIQQLRDPS
TTIYWQSDGPQPHLVTIEFLQRTALASFSIYVDSTLDESYTPKTLSVRVGSHHHDLREVK
VVNLQAAVQGWRNITLATPTKGYRKVFVLQVAIIANHQNGRDTHLRALRVHPPEQDKPIN
QGSILNTSNFMDFSSTIR
Download sequence
Identical sequences F2U8B3
PTSG_04356T0 XP_004994444.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]