SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04373T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04373T0
Domain Number 1 Region: 170-322
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000689
Family Growth factor receptor domain 0.00046
Further Details:      
 
Weak hits

Sequence:  PTSG_04373T0
Domain Number - Region: 116-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00698
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_04373T0
Sequence length 382
Comment | PTSG_04373 | Salpingoeca rosetta cysteine-rich with EGF-like domain-containing protein 2 (383 aa)
Sequence
MDRTKADGFGGGNTDWEERSLGAYATSETRLQEILEDTCESSKDHSCHMQLEQAEETIED
WWYDRDVTKDGDAEDTLREMVCEKALRVCCPNGRYGPKCKPCPGGAENPCSGHGRCKGEG
TTSGSGKCTCHTGYKGKSCNKCKKGFYAVDEANGDEDSSSTTTNAITCLKCNPACTACTG
PGTSSCTKCAEGYVYEEGNGCVDVDECAAGTFKCAGDQYCHNTPGNYTCRSCHVACDRMR
GCTGGTASDCHECARGHRRETEGDSTATCVDIDECAEGMKVCETGKYCRNGPGWSECRVC
HEACDPSAGCDGAGPGACRACAPGYRMKGGDGAGCADVDECEEQGDSVCAEGNKVDGACV
DDNDSEAQQEGDDKKSPGHDEL
Download sequence
Identical sequences PTSG_04373T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]