SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04390T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04390T0
Domain Number 1 Region: 765-862
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-18
Family Cadherin 0.0017
Further Details:      
 
Domain Number 2 Region: 1671-1765
Classification Level Classification E-value
Superfamily SH2 domain 9.69e-17
Family SH2 domain 0.001
Further Details:      
 
Domain Number 3 Region: 979-1065
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000114
Family Cadherin 0.0072
Further Details:      
 
Domain Number 4 Region: 655-755
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000157
Family Cadherin 0.0039
Further Details:      
 
Domain Number 5 Region: 876-969
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000186
Family Cadherin 0.0027
Further Details:      
 
Domain Number 6 Region: 1062-1180
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000314
Family Cadherin 0.0062
Further Details:      
 
Domain Number 7 Region: 1189-1302
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000585
Family Cadherin 0.0073
Further Details:      
 
Weak hits

Sequence:  PTSG_04390T0
Domain Number - Region: 1313-1386
Classification Level Classification E-value
Superfamily Cadherin-like 0.000414
Family Cadherin 0.011
Further Details:      
 
Domain Number - Region: 528-597
Classification Level Classification E-value
Superfamily E set domains 0.00042
Family E-set domains of sugar-utilizing enzymes 0.047
Further Details:      
 
Domain Number - Region: 476-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.01
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_04390T0
Sequence length 1838
Comment | PTSG_04390 | Salpingoeca rosetta hypothetical protein (1839 aa)
Sequence
MAALRMLGLCVMLLVASAAAQRIHVDKTSLTVSEGFYEVITFTLDEPIICTTQDGECAVV
IEVQNPHPNQVAIDNCIIKWDWQDWHQPRTLVIRAVEDFVDDGTFEGMIVTDPAISRSEY
YKNYNAADIVIKTRPRRSAQCSGTGDPHYHTFDRKYWHIVDAGRYVLYKTRSRTFEVQVQ
TRAYPARHCAFAAREDNDVVVVWACNGNPVVRRSCGSDECRRGGFPKLSIRGSSRRANYY
VEFKSGAMVRADTQPYYMSMYLTAPGRDFNDVEGVCGNFDGNPNNDAPVYYARSVNQLWS
SQRPSYDLFAWYPSPSPPSPPPRSYEECTYEEPPFVRPILNRPDAEDITSFIKDLNLNDV
IDNEDVVIGGSSVDESLNAMDRNLAVAQCDDVISNSHVVAVCQNNLPGFDFTAYIEDCAD
DLAETSNVDFIEDALEALERDCAERASRDLNTWETDENENPVEPNKEIQTNICPSQCNNR
GTCDEGICTCDEGFLGFDCSIDTNARPVITSLVKPFCDTKGINECTGRLSVIGEGFWNSD
KLRCRFGDMETDAFFLGSMEVACAVPNKVHSGSDEETAVVQVTVDGDNWSESQEFVFTWY
DGVCQVCNAHGCGPNPESCTIDGTCYHNTAPNSDNICQQCDPSTSVTEWTWTYQNHEECG
PSFPKGTPTVTVVGGAEAGDVIYTVDASNSKVAADTSNVITYSLTGGDGLFAISNDGVIT
AAQAFNVLDLDVTFNNFLSIVATDSAGNEATTGIVIDAVAENVDPYFSDSYSVEVPEDVQ
VGSVIISVQAQDRNEDDSLTYSWFSTEEGYGDYFLIDETTGDVTVNRELDFEDRDLFTLV
VRARDNGGQTHVTTLEVTVTDVAEAPNGVAIDSDSLEENSAPGTVVGTLSTQDPDDVDGT
QSFTYSTSSSVFAIDGDKLVTAPGSSFDFEAGPTEYEVEVTTTDQDGLTFTDTLTVSIVD
VNEKPYNVRLNIPGSEQGNFMIEESAPLDSIVGTIEKQDDDADQTVLCSLASTDNGHFEI
SGNNLVLIDQLDYEEDNEHMITVVCVDDGTPTLASDPVTFVIHVTNVDDGPSDFAFEGTD
VSVPEDAQVGDVVARVVAVDVDGGDSAFDFSIVRGKFAVPNAPDCEAQQDGSVRCVVDLV
LAEALDFETAEEETFTIEADSNGRVGSARLTIPVANVNEPVSAIQWADGVNTIPEDVDAG
VLVGTLLPVDPDTTTMGVAYNFELLTNTDVFELVPLMASAGSSRRRRANDADAYGAEVRV
KDPSALDYEDESKRSFTLSLRVTDNADTPVSSVVEATVEVTDAPLRLVTAPDFITVSENA
SVNTQVATVSLEGNDHAGVPYTITLVDDANGAFRLDGDKIVVNGALNFEVAQAHELTFEV
DTQETPLPTFAVVVGVRNVDDAPVISIDSVMQEVNSDIRVGQTVFSVDATDEDGTGVDVQ
LEVSAGSLTRESLLLQVFGYRASTQSVFVRQTPSTAGLPLGTYHMRLVGTSGIGSTSVEF
TITVFDDCRSNQCAATETCVDRFGSYDCCEGATCVNSADAGFDTRFDTTTTTTQAPSTSN
SADTTTDENGNGPNGGNVDLSRTDASNSGASVGLIVGVVVGAICLIALVAVVVILAMRRR
NDPGRLFLAAEEGSKTYMSNPTYRSPQEPVYAQADGRQTVAFVPGASNPLYEWYQPDMTR
QECTDSLTDAPAGSFIVRDSKATPGWHMIGVRTESAVVHEKIKRGDDGMYELLPASNAPQ
PAFQDIPSLVYHYSEPRADVPFVLSASSLSNPMYAMSQNASTGQYAYAPGSAIPHDAAAP
AVPIKEKERAAVEQVAAMDDGELYTNTTDAQAALHSSA
Download sequence
Identical sequences F2U8E8
XP_004994479.1.12839 PTSG_04390T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]