SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04397T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04397T0
Domain Number 1 Region: 9-250
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.21e-54
Family NagZ-like 0.00034
Further Details:      
 
Domain Number 2 Region: 251-483
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 2.22e-40
Family Beta-D-glucan exohydrolase, C-terminal domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_04397T0
Sequence length 614
Comment | PTSG_04397 | Salpingoeca rosetta conserved hypothetical protein (615 aa)
Sequence
MLSCRPRHVRSPNININRDPRWGRNQEVPSEDPLLNGEFGKLYTMGLQQGEDSRYTKVVV
TLKHWDAYSLEDSDGFTRHNFDAKVSNFALMDTYWPAFRKAVMEGNAKGVMCSYNALNGR
PTCTHPLLTKVLRDIWKFDGYVTSDTGAIEDIYAKHHYTANASAAVAAALRDGRCDMDSG
AVYHDALLDAVNSGECSMDDVDRALYNTLKLRFELGLFDPIEDQPYWRINASSINTTYAQ
DLNMKITLESMILLQNHNNALPFKKGRKVAVIGPHINAQEALVGNYLGQLCPDDSFDCIT
SPLAAIEAINGMSNTVSAMGSGVLACTDASIQEAVNVAKDADYVVLLIGINDTIEAESND
RTSIDLPQCQHKLTAAIAHLNKTTAAVLINGGMLAIEQEKKQLPAIIEAGYPGFYGGAAI
AKTIFGDNNHLGGKLPYTVYPADYIHKINMSDMEMTNSPGRSYRYYTGQPLWPFGFGLAY
TTFSVQSPGPSASTFATGSNTSFSLPVHVVNTGKRTGDTVVQVYMAPVSLPHRSFSLKKQ
LIAFERVHLTPNQRLGVTIPLSADVFNMVDPVTGNVVSTPGSYRLVVSDGVAPTLRFSVS
LHGDEVVVEKFPSV
Download sequence
Identical sequences F2U8F8
PTSG_04397T0 XP_004994489.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]