SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04427T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04427T0
Domain Number 1 Region: 255-421
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0000000133
Family beta-glycanases 0.067
Further Details:      
 
Weak hits

Sequence:  PTSG_04427T0
Domain Number - Region: 89-136
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.000754
Family Type II chitinase 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_04427T0
Sequence length 494
Comment | PTSG_04427 | Salpingoeca rosetta hypothetical protein (495 aa)
Sequence
MKMPRFSVAGAVLMATLALCAGSFLAHVRADADTKFVGGYILMSATRNGHAAGLDELASL
ADNAKSLPVSRVIIGFFDPTMVYMPGSQTLNSTGLNASSTGDYGFAKVKESIGKLQKGGV
EVFLSLGGWNYNCFPYLYMRYSVGGYGTHTPNYWKIDQYGQGNMSNCNDANQYCWVCEPP
SEGTDLSDFAIFPTVPGSDTWQQAVKFVESNAKGNETPAWHYEMVPGRPWTDPKTGIQVQ
VPGRYDFVRLNRDPYQDFVYLAKDLGVDGIDLDYEEFWHADYFKYGNGPWWLPQTVYKYA
AIAKTLILHIQNIMPKLKLSTAASAVGGWSSSWWGGNLKTSMYYLNLWYPSLVDFMTKGK
NAGGVNVMTYDLSDNPEFHECPEPNICSLSDQVKFYMQQYKAANIPANVGYEIGTPAYPS
PKHDPTHQLPLTKAELQKIISEVQGDCDGGFFWELFKPYSSGQASPTDTAQAICSTVLGD
ADRCSGSVPTPPSK
Download sequence
Identical sequences F2U8J0
XP_004994521.1.12839 PTSG_04427T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]