SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04485T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04485T0
Domain Number 1 Region: 234-349,788-890
Classification Level Classification E-value
Superfamily TPR-like 4.22e-23
Family Tetratricopeptide repeat (TPR) 0.0063
Further Details:      
 
Domain Number 2 Region: 1317-1462
Classification Level Classification E-value
Superfamily TPR-like 0.000005
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Weak hits

Sequence:  PTSG_04485T0
Domain Number - Region: 914-970
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.068
Family PspA lactotransferrin-binding region 0.0056
Further Details:      
 
Domain Number - Region: 506-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family Merozoite surface protein 1 (MSP-1) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_04485T0
Sequence length 1472
Comment | PTSG_04485 | Salpingoeca rosetta hypothetical protein (1473 aa)
Sequence
MSRLLCRFTHVRLLDTTNSAPITFHLRPRIVRSVWQLAVVCALVACATAVNHWMATSTGV
IAPADDFEFESVDPHSEHLSAFVFHDHRIGRYRSTATRIDEAYFLDKPALSILKVDMPDV
LAKTRDYDPAVTVSTLDLHQPLALMLSHKGLDAREFVDIQSIPPKFKGKAPICTDLNLSK
DAQALFSLIRSEGLPRTAETHLLPFLWLELAQDDDDETTVPPKFLKKLGGGLAHALSVYP
ESWIVHFLSGLYWRAGGDASSSVECFRRALYLAPDPFRDLPLVSLSAVLLRANRTGDALV
LIDSALSTTDSLYLPHMLKGIILLTANRTVDASTSFAKAIQLNRGLTLGFEFLLATLSDV
KAAAATARREREINFRRLTMVLPPDLTWADFDYEATADMCAGATCTAHAECNPLDGKCHC
MDGWLAVQGQCVADDLCEDIQCKPNAMCRGGRCYCRPGYVASNGACVADPCAGVDCVEHA
VCDPNYGLCKCIPPFKAYGPECVTEECVGIVCGNNSFCQRGRCFCRIGYKAEDGICIKDE
PCHRQQCPANATCNPDDGHCRCADGFVADMHNNRCVPEHEAVESTTPLAADEGDDNTSDD
HEDDGGDSGVLTKASDFDTGIFDPNDLEDASLQPTMAVGVKPGTSADTHSGARRHLPFEE
EDFITADKCTRAMRRMPSWDEFSSTFLPPVPDYDLSLQTLLATKIRIPPNTKFQQPFCTQ
GQVVFSAGTMDRIPSLAINASLGPGSTYPEETGLKDIAQHLLGFAMPVDEFGHRIADVLS
GHETIWALYDLAALYWRVQGKHTEAIRCIRASLFHSPPEYKDVALINAANILLRRNSLAD
ARAVAEVALATTQHHRAICHFTLANVLFTRTELVEAIEHYKDALRYQPSFQLAEHSLRRA
MCAQQYPLANMYSEQETKEERAAREQLHRQVKDARALKDRLEHLKQIVEAYDESSEVAQL
KSQLHDAEERLRTVFLRQKMESRAKPEERLLSSLQYKLRLRTEEEKQEMNDPQLADLAPF
DAMLHDLDPVDSLKLQQQEGKALVDAAITSMNSHHTHSDDDDDRDDGGSTSDPVASRLIT
TSPSIPTLIEFVDNALVGHTNQTAVQVLADPSWPTAAECSERLQLPEPTLHELEKLSIIS
MVNGDVLGAAGDSLDGGDDGRGGAARRRKKRRSKRARRSRRGGSSGDDGDGDGDGEGSLT
LQESAWAVMERLVEEEASTGGSTWLADDVALLRDELASIASAPSLESQRKQVGFKLPICR
PPAAMDHVALDALHAVANRYDNKERVPEETDIQAMIAQLEEPGLGVKEFAIRTTELLKRE
PTHWQANYIASFFWRGTGNTSQAVECLRTAYAFAPRRQHLHIFIGLANALSHGGHLVDAM
AAAETAIRPHFVVQTSYFQSNLSIMEPLDAVCHTTMANVLSRLGGRSTEETIYFYEAAFK
LRGTHSSSLLPRLQLLRCQQRYLQPLATSHPT
Download sequence
Identical sequences PTSG_04485T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]