SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04518T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04518T0
Domain Number 1 Region: 207-536
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.52e-52
Family beta-glycanases 0.00000121
Further Details:      
 
Domain Number 2 Region: 7-115
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000595
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.0033
Further Details:      
 
Domain Number 3 Region: 651-738
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.000000000018
Family beta-Galactosidase/glucuronidase domain 0.0027
Further Details:      
 
Weak hits

Sequence:  PTSG_04518T0
Domain Number - Region: 542-648
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.00345
Family beta-Galactosidase/glucuronidase domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_04518T0
Sequence length 761
Comment | PTSG_04518 | Salpingoeca rosetta predicted protein (762 aa)
Sequence
MQVNTTQFDVPWCYTSNVSVTRTNADARIILDLHGINYKADVLINDNLVRSHEQVVGTFR
RFLVDVTDALPWDQQHGEQSAHAALTLRVYRPQDRSLPPSNKDTDLAISFVDWAPRPPDS
PCCFHTLPSGVMVDSLGAAVVSINSNHDHTAHGTHADGDTTTLEGPVCANVSITATVHNM
LSTPMRMNVTASVQGNQATLASATRHIGLRKVTSVRDANGYRLFYVNDRKFMVYGGGYSP
HLFLRYNTSYQRAMLEKVKQMGLNTIRLEGKMMTAEFFEMTDEMGIMVLPGWCCCDAWQH
WSDWKDEQHLIAMESMRSQFRRLRAHASVLGFLYGSDEAPPSHVENEYLRVREDEYWHLP
FISSASNVSTPAGGRTGVKMNGPYAWVPPLYWYQGLAHVSSGAAFGFSTEISPGAAPVRL
RSAKKMFEANELWPINDVWDFHCGSQLGLFHDLRFFVPPLTARVGAANSIEEFLFKSQLM
TYEAERAMFDAYSTFKYRNSTGVVHWMLNNPFPSLIWHLIDFYGDGGGGFFGTRAALLPS
THAVFNPSSGAISVVRNDVVQGSSLLDLHVQIWSTGSELLWNDSVRIGSIGADDALLDVT
NIQTHLSHFCAAQPRRTLLIHLLVKNQDNVTEDDQTYWHPCRPDVLDWSNSTFYITYCSQ
FANFSDLCNIEPAQLDIHLVDAVHVQVTNPRHTIAFFVEFDVIDEESGVSVDGYAFNDNY
ITLHPGATRTLTLNQAIEGDVKVAYKDLSSSHCTREPTTKM
Download sequence
Identical sequences F2U8T4
PTSG_04518T0 XP_004994615.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]