SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04589T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_04589T0
Domain Number - Region: 538-728
Classification Level Classification E-value
Superfamily Tropomyosin 0.00105
Family Tropomyosin 0.0022
Further Details:      
 
Domain Number - Region: 277-481
Classification Level Classification E-value
Superfamily Tropomyosin 0.0209
Family Tropomyosin 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_04589T0
Sequence length 772
Comment | PTSG_04589 | Salpingoeca rosetta hypothetical protein (773 aa)
Sequence
MMEGEAQDHLQVQQQQQQQQQQQQQTREDLLQSLPMRQASSFSSFGGAGSVDDDDDGDDD
DGDDSSGDVVDDDHNGERQSRHGRASGHGGGHPGFTRSQAAGGHASDYGFDVTNAQAQST
TRETIALKRQLQELRTRAEAVVAENEALHRALEQSMQQNDGASDQDLSQIRLLMQEVGLL
TKTNTDLKLQLKNAQSSAKQHLQETVSLNDELLNRTIQLQKLEAELKELAALRWGNSDGN
CDASAQGTLIDRLQQENEQLKQQLLERGGDGSSGGAKTNKAAARVASLQKQLHDARQLVE
AKEQHAAHLERKLQQSSEEVEHLQAHKRRFDDSRQAMQETITALNTRIADLERDKEDLRT
RLETTNQMFDELRQTRAEAVEGRQIAEEQLTQLKMQHAQLKTAMQQTIEAESIKLEEALV
DREERIATLSHRLERQQQTSDDLRAELDLAKAGPQDQLHGLQEANGNLMRSLAEAQQARD
DFKLQCEIAESQMAAMQEEQQRTRREHLQQYACVCMSVRVDHSLSCSRSAFASLKATTKH
FKQKLTELTQERATLQSELNKANTARQTAQQEAAAEVESLRARLQRVENQWKARLAHAEQ
LQRKAVVEAEHLMDSRQQHSASLVRDARFASSRLQQRLEEEEQRCRQLETKNHSLKRALA
KANSQVEAAQEIIDDDAAHVEQLQRQLRTVHHKHQAALASLQDSMQRETALDGELQALRV
EYERLKVSLPLARTRELAVGAGMHDDAAGDRDGDGYGAYDDDAAHHHVSVAG
Download sequence
Identical sequences PTSG_04589T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]