SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04590T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04590T0
Domain Number 1 Region: 33-120
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000139
Family C-type lectin domain 0.01
Further Details:      
 
Weak hits

Sequence:  PTSG_04590T0
Domain Number - Region: 389-430
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0471
Family TNF receptor-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_04590T0
Sequence length 1011
Comment | PTSG_04590 | Salpingoeca rosetta conserved hypothetical protein (1012 aa)
Sequence
MALAAVLLVTATLFSAAPLISSAEAHLINIPEDLQYKFFAVPEATFDDANAACVAHEGTL
TSIVSTQENLEINRIRAADTSGHSEFWIGLRNIGCDFEFLDGTPYRPDVHEQFLLNEVDP
VTCSFSTKVYDLAMVRGGRWAHIDNRIGLRNIGCDFEFLDGTPYRPDVHEQFLLNEVDPV
TCSFSTKVYDLAMVRGGRWAHIDNRRISRCALDQFLLQEATWSSDVACKNVSTCHPTTEY
EATAPTATSDRECRPTTECGEGTYITAHPTPTTDRECARVSPCRPTEFAVAQPTATTDRV
CMATRICTPGLFEAQSPTATTDRVCVAKNTTCDPDSFRNTSTNTCELLTTCQLGATFEVL
APQPTMDRECAPVSQCGDGQYETNAPTLLSDRTCANISMCGDGMYMVVPATPTSDVVCHS
NTACRANEYEAISPTPTSDRSCREYDEVPEFRGADGALLLNLYDYLVFVDGGHLDLGPFH
TLAESIMQLGPSGFAVGDVIARYRIGYLDNGKPPLVLITWARAVQVLVDYAASGGREGAE
WIDTSALELRPTANNGRDNMLEYELVYVKRVQRLHDADIRALVVNIDAINVYSPVCRPDK
DTFFNEPCRSNVTTLFYLDTFKGCIPHINRVVLPGEVTKIEWDVPQPTIVGNPLLFQTVE
IIPLMAEPGADPDNRLFSQGVYDVVYGIEPQALTRNVECRIRITVALGEFVEINGVAADV
ISTSPYAENAYLLDNSGTHDVAIADSIRVPANFRLSVGLQLAAPKGRRIHVTVPPIGEVV
VRFQVGYCSDNNETITVGAAAPQITFDGLDEDVAQPIISIDSASGLSQNGRCYNLFAETA
PITADIEFDRVSLLLVSKDLTTVTHPVAKLVDVLDIDGASVYSAGHRAKFFEHLLASYST
ALPQPWSRITATLTIPPPDQDLHGQVFESFQGNNNFAAAADGLTTRESSTDDDATATTTT
TTTTTTATTTSLPAPYDPSTPFLTLDDNVPPIFISCPSDISIVLPDNAVRM
Download sequence
Identical sequences PTSG_04590T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]