SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04594T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04594T0
Domain Number 1 Region: 32-237
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.74e-18
Family Amylase, catalytic domain 0.0039
Further Details:      
 
Domain Number 2 Region: 246-331
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000156
Family alpha-Amylases, C-terminal beta-sheet domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_04594T0
Sequence length 341
Comment | PTSG_04594 | Salpingoeca rosetta predicted protein (342 aa)
Sequence
MMAGAELRWLAVAVLWLSVSAPGVQGLIARPALPPRGWNSYDSFGASNGTETVEVAAAIS
KSLAPFGYQYVTIDEGWFRESDNSIALDQWGRMIPAKSKYPFANGSFRELATTLRIRNLT
LGLWTMFGVPADAVARRLPIRNSTYTADQISLGVNTTCPWAQNLTYAINTTHPGGQSYPS
SVTSHFKVAYRLQPFKPQRRMVMTLWSFSGSPLIFGGDARTTTEDDIAVLTNTDILDAQK
YISNFQLRRLVTEGPVEIWSGDNADPNAGSDAFYIAAFNLGNATVDLDIPFPQIGLGGHK
YQLLELWTGLPTAPADRLRQTIRPNSVLAFRATVASADEAV
Download sequence
Identical sequences PTSG_04594T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]