SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04695T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_04695T0
Domain Number - Region: 571-613
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000118
Family TNF receptor-like 0.0098
Further Details:      
 
Domain Number - Region: 664-703
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00612
Family TNF receptor-like 0.0087
Further Details:      
 
Domain Number - Region: 147-181
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00706
Family TNF receptor-like 0.0064
Further Details:      
 
Domain Number - Region: 79-121
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.046
Family Di-heme elbow motif 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_04695T0
Sequence length 928
Comment | PTSG_04695 | Salpingoeca rosetta hypothetical protein (929 aa)
Sequence
MVNANKYSHDPVDAVAKTLSGGADMELGETCFTTNGYLEQAVQHNHTTIHTVHNNTVRRV
LKDSFITGQRYVVFVCIDECTICGFNPPVTAAASASAPMASMSSASGCAECHSTRVPNAI
PPDATNCLNLCDGNLTSRALPIALPTGYYAKDHRCVPCTTCGMGTWASTSCSASSDAVCS
PWTECKPGQKESVCLWQRRARPCVSCTLGMEYQPLSDRASCFPTSVCEEPFSETIPPTLT
TDRLCSCDTLTCNLITQLFEEMVCAWPTDEQLDVVLDVCCSSQGDDGIRNTIRQMDADEA
RRSCPGCTDTCECSTGFILVYDADSANCCPCDGVTEFSPSIGGSKCEPIEECECGQEEVS
APTRSSDGVYRDCPAGPIDADSDGSTGCQMCAGHYTEAGSHGSCSSFTCHASTHDHHDSD
PATPCNDVTDCASGFEEVQAMTLLISDCVSATSVLEGTYKAVSGQPGRALPPRHHSTFPR
MAVSKCEFGTFQSQVPTLDSDRECTLECSGCSSDRYEIRACSALEDVQCAGCSACSPKHI
HPARLRLARMTCRASMQSADGVRAHRLCHLITKCGPGEQRTRAPTSTSNTKCEPCPIGTT
DHDRNPLTACQPCLYGHYVPAGSIGSCKQFLCPAGTVDLDRHNASTPCMPCQAGVDFAAL
SGQRDCTPVTECDLGYEEVVRPTIFTDRQCRRCIEALFYRDSNTDFSTRVCRPASLARLR
RPHPPSARTVSARWARICPNNNTFISRPLMPTQNRICSPWMQCLSSEYELVAPSLVNDRE
CQRVRSCQHTEAHHRHCRLPQRGLYALLFSRSVSGDVTVMGSTASPCEADVSWTTRPFGN
ELKASDAVGSWTTTALLEETPAVLMVVVGVHAIATATTADEVVVVIVFAFLTSSSNGNEV
GTVLLVGTHVLAIVGAMAGSSSCCNARQ
Download sequence
Identical sequences PTSG_04695T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]