SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04696T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04696T0
Domain Number 1 Region: 104-248
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.000000004
Family NagZ-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_04696T0
Sequence length 303
Comment | PTSG_04696 | Salpingoeca rosetta predicted protein (304 aa)
Sequence
MRATAVTALLWLVAVAVSVVQAQVQCTNLQDQGTFAFAGNMAQTSMTREACATLCYTFNF
SLSAPSSDCNEPCTGVSTEMCRAANRMNINPGKLFRQTRSHRELPFCNTSLSIGARLDDL
IGRLSLQEKAGLIGPDPVTSPCAFLDFGVKRLDIPPYLYLVETNTAVAFACIISQDMCAT
TFIGPTGLGAAFNRVVSTEMRAFNNLNWHRGGSVLQKIGLTGTDPCLSGECAAADVTGCQ
DGTDKKYKKMTAATLFHMHTWWWTCHLHCCHRSIAILGPKHFDAASVETSRMAFNGNIST
FDL
Download sequence
Identical sequences PTSG_04696T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]