SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04724T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04724T0
Domain Number 1 Region: 820-984
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.29e-30
Family Protein kinases, catalytic subunit 0.00083
Further Details:      
 
Domain Number 2 Region: 258-520
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 2.75e-26
Family Galactose oxidase, central domain 0.02
Further Details:      
 
Domain Number 3 Region: 471-651
Classification Level Classification E-value
Superfamily Kelch motif 3.53e-22
Family Kelch motif 0.01
Further Details:      
 
Domain Number 4 Region: 1-178
Classification Level Classification E-value
Superfamily Kelch motif 4.58e-20
Family Kelch motif 0.019
Further Details:      
 
Domain Number 5 Region: 731-774
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_04724T0
Sequence length 985
Comment | PTSG_04724 | Salpingoeca rosetta predicted protein (986 aa)
Sequence
MFVFGGLHVISDTDSGQIKYRVTNDLWMYFPDFKRWRNITQGGPTWPYPRFYHTANSINV
GGKQNMVIFGGIDNSHVWTYNYESEEFNLFSPGAISPTPRMLHSSTSYNDTLYIYGGCAV
PTGEVPGLDLCEEGSLGDVWRWTAGNGWEELLIAHPRIHRFSAAMFFYRGSLHMLGGFPH
VSAFDHDTDADVNHYRLPLPTDWALADTPPPTWQAAITPETARPFEDVFDPDLDALSVDP
FLLFNDTIRSLSFNVLPPRLGFASITQVSDDTFLLIAGRSSALTAPSNKVFRFNGQNMTW
DVLDENRFDTNIARRSGHCSVATTAGSVLTFAGAAPLSFFSDVASFEAESQSWAEPLINT
HPLTGIFPAGVTYKNYYVLHGGLSFARSEASSHVFLLDLSTRRWVNVWLHNQPPVRRYGH
SVNVVGNNLYYFGGATALSSDPTAISNAIFRINMDEFNIYHDGPGITELRPHRRTRHSSV
YFNVTHSLYVFGGRSHFSTYCDLWRFDIAGNFWQPLGNCTDNQGWPPARSAHVAFILDDF
MYIYGGTGDVNVLADTYADVWRYDLTAQSWQHVADASPAGPRFSASVTPLPGGKKVIIAL
GIDNLKRGVSRLDLWDVHHVDNATSGDLDLEWTRLHVRNPIDRYAHAAGFHRFFRVFSGR
RGILEDLQGGALEMEETALRLGCNVGSFSEDFLTIPCQPCPVGTFADFPGQESCFACPGK
STTLEEGSVSVTNCSVCEPNSCRGNGRCTIDQNGFRPSCFCNFGYSGADCSVNWLAIVLG
TVLGGGSIVAIVFLTIRYFRRTIVQAKNDSALHQKLLAESQIELSLLERAWEIDVEDLTL
YEQIGEGGYGEVYRALWNESVVALKKLRTAMAMLDSFFVDEFQTEVRLQRTLRHRNVVLF
FGAGVFPDGNPFLVTEYMRRGSLQQVLASAWPGGVDRNDDAVIETINPDDRLSWGLRLQF
ARDAARGMTFLHEQIPPRLHRDIKV
Download sequence
Identical sequences F2U9I8
XP_004994046.1.12839 PTSG_04724T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]