SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04829T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04829T0
Domain Number 1 Region: 330-471
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-24
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 2 Region: 118-231
Classification Level Classification E-value
Superfamily C-type lectin-like 3.37e-18
Family C-type lectin domain 0.0026
Further Details:      
 
Weak hits

Sequence:  PTSG_04829T0
Domain Number - Region: 12-31
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0997
Family C-type lectin domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_04829T0
Sequence length 473
Comment | PTSG_04829 | Salpingoeca rosetta hypothetical protein (474 aa)
Sequence
MKVEKEDNGASQIEWKATRCSRTRSFVCERAGEADGSTTTLAATTGAATTGAATTGATTT
GAGSTGGTTTLPDTTEPSLTTTSTENEDDDDDDEEENESTSTSTATSGASTTTASNGGTI
APTGWVAHGGQEYQLFGDGDANFDEAVAFCENEGGSLASVGSASEHEFVAELVAVQSEGR
RGNDRVWIGGVVDGDTQELTWVDGSDAFDFGYPWDEPEDVWGARRPACVEMKDEKEDNGA
SQIEWKATPRAAEADGSSTTRAATTGATTTGAGSTGGTTTLPDTTEPSLTTTSTENEDDD
DDDEEENESTSTSTATSGASTTTASNGGTIAPTGWVAHGGQEYQLFGDGDANFDEAVAFC
ENEGGSLASVGSASEHEFVAELVAVQSEGRRGNDRVWIGGVVDGDTQELTWVDGSDAFDF
GYPWDEPEDVWGGRRPGCVEMKVEKEDNGASEIEWKATRCSRTRSFVCERGLA
Download sequence
Identical sequences F2U9T8
PTSG_04829T0 XP_004994146.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]