SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04878T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04878T0
Domain Number 1 Region: 157-482
Classification Level Classification E-value
Superfamily Subtilisin-like 1.22e-78
Family Subtilases 0.0000000211
Further Details:      
 
Domain Number 2 Region: 554-657
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-24
Family Proprotein convertase P-domain 0.0021
Further Details:      
 
Domain Number 3 Region: 674-716
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000487
Family Growth factor receptor domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_04878T0
Sequence length 991
Comment | PTSG_04878 | Salpingoeca rosetta prohormone convertase1 (992 aa)
Sequence
MRSMTRRRGRGAIALATLLMTMVLGSRCHHVTASNVTDTNGDELQDKRPGHLHSWVVEID
AIAGNTTQIVQAIARHHSLEVLDELPFRPNAFHVVQHECGVTVAGAAGREHHAPSRCRLR
RSQDWEPVGQRTQLLLAEPHVTNVMHQPEHVRVRRTGSDPLWSQQWYLKNDAFPSLQQSP
VWDEDITGSSVVVTIVDDGIDYTHPDLEDNFYPQASFDFNDNDPDPMPRETSTNINKHGT
RCGGVVASARFNGVCGVGIAYTSKLGGIRMLDGPVSDVVESKSLGFERDVVDVYSCSWGP
ADDGIAFEGPGPLTLQAMEHGVAFGRSGLGSVYIFAGGNGGPTDDCNADGYSSSIHTIAV
NSVDQTGSVPHYAESCAMALTSAFSSGTYTTKRIVTSDLHHQCTTTFSGTSASAPQAAGI
IALALDANPCLSWRHVQDMVVRASSKDNLNTHAGWQVNGAGLDVSHQFGFGLLNADTLVT
LAQAERTQYPHQARIVTDTHRPNLVADHAHSQFDDMLVTCDDGTASTGGDNDAGGDDDDD
DSNNSNNNSGGGDGGLTSSTRNRGCVKRLEHVVVTARFQTAKRGALQLTLTSPSGTRSKL
LSSRPSDTGSLTMTWEFGSVQFWGEGSAGVWRLQVSSSSSHASHTLLAWHMTLYGTGGNL
KQGKLTTQRDTLTLHNGRTCRVCPKGAYPDGVGGCRECSSSCNHGCFGPGKRDCLSPLSS
STTTSNEQLRTTIMWAAIGIAVAASAYLAFSFVWTRCRARVALLALPRTQHDDGVDDDND
GVDSRRDNTGSSSGGRGRGYTQQQQQQQQQQQRRDNLQALQPRLQDDGGVHVFDMDDTCA
RDREHMQAISETNMPFVVSFNNDDYHSPASSVASPSSPTARQSLHLYPSNDGDGSDTAAV
ARPHVDGERGRVHAIDHNTSSINSGSGDGVAAEQFGGGKRAVEYRAVARARAGTTMPGSS
GDGLSSSDEDDEDDVFSSEAHALTSPLLSKV
Download sequence
Identical sequences F2U8W2
PTSG_04878T0 XP_004994196.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]