SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04891T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_04891T0
Domain Number - Region: 156-221
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000255
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 295-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0251
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_04891T0
Sequence length 4808
Comment | PTSG_04891 | Salpingoeca rosetta notch (4809 aa)
Sequence
MPQNHHRARIPHLCLSQHLQHIHSHLVMLLFFLLASCLQAQVLAQSDLCQEAPCGFVNST
CRVEVHESNDTATVYERVCGCEAGYTLVLPPAITTTTTTTSTTQPVNGNTTTTTATTITS
ITANGNTTAPAMTTAAAFHVLTPSYANATCQDINACAWFPCGDNSICTDLPAPAPNSTLG
RTCTCAPGFELAPGQPADGNCVDIDACAANPCHTNANCTDLPAPADGTETGRVCSCLEGY
AGDGITNCTNINACSFFPCHPEFGVCTDLPPPAPNSTEGRSCRCDYGYTGNGEDICFDVN
ACRRNPCDVNAMCTDLPPPALNRPEGRICDCYPGFFGDGDYCIGEPLVQVVAAAENNAVR
VGSYVTAFATIPVTASTSNVSVLLRTQHDTPFAKLVFATTPVMAFVVNGTIHQTFNSTDR
NVTGAALPSAAVLTWGTNTYNSNSNNYSSIPFAFERVNDTAVLLSFGLLDTTHPASPPAV
AVTAQLAVLGDVSAGRQEELSIRATVVHDGLHPVPISATAYASVVHPSVDAVFSPSQVPP
FRNALETTTVAIAFTAPSLPLYNATIAVVAGAQGGGADASAQVINATLAFPCLFATQPNT
TATTTGPATANSTWCSGTSATLSALNTTAGGVAEFEVELSLTDLARSNATVTLPEIEVSF
FAWPITPDTTTTPSTTNTTGSAIAAAPAVNPRYTQRLQLNPRTMRLPTISATTTLSTISC
FASATTAPPPSSSSSSSSSPQSDDADADATAVVVSAPGALLYMCTEIAGPYLRFDLGLQY
SLQAGLASSVVVSTNAPEDAVGGASGAVQAIVQAVNTTTTNATAAAGDSDTDRVLLSARD
LLVNTSTNSLIIQTAIRISSEHTPLLTAGQQLSIDVQAVALPGLASAQAAIMGASHFAVE
LLEPALELAYVAEDVPHHLDAGDVIAHRIHLAHRPWSSAPAYDLCVTLTASPFLSFISPT
DTKLLLPQGLNCTLSNDQSGHMASNWNDDADDGFNTLTFCCAQPLSPTNNSSVSALVLST
VAGNTAPLTPLYFAATATYTSAPPPPSNTSSNSNTTISSSSIASDPNTVALASAVLSANN
SSLTDPVRHYVADVERNTTHVLAVPLVHEGSPPSTAAGAVYVNDASVVQEVCVTAPFSPE
YQDPLPASIVDGVQVHLLLELESSITSSMTPTNWSIVPRSIQHTAFGFEATLLPAETIVT
LNSTFSRVVLRDMHSTASTTHSSTNLTLTGALQQLLSNMTASTVDDATICFDVQRQSETA
AGATSLFPVQNAAVVALNETTAASARSLLTVEYRTPSAIQGWPAVELQPSPSPWFEIGTT
VAPTSRISLHATDNADTPSNDVSLHEILTFEARVELPFGEYNLTLDFVLDPYTNKNAFVV
PDASDFFIASLPACLSNTTAFAVEVPTMATPKQVRVVFGTVQCKQDPSEANTVFPADNTL
KVQLQTAVVDEHAADPLLSANRRRHFVDLTAEYTSALGTNTTAVWWADVTVVHPQLRLLT
WMDTDARDSEAGDVVTYMFYVTHDVNSTAPAYDLQLLSTPNVHHAIQNDTIKCLEFCDAE
EATQVTATDQGGLLFTIPRLPLGKNAYWRWKATVLQTVPAGRRLRSDYDFRFDTHPRNAS
TATPLDDSAGVPLVGYEDTESTYHTMDIEDANFTGLPVFSSIATTRESPRYDVVPDELFI
LNYTITLPASTTDTRVTIYMPSAYIALSGTVTGVGGLIRNSSLDAGDMADLLSGGRSVKF
DFGRVQRLIAAAASSSSSSSSSQQNGTTTMEAEEQASSLFMSVLCHAEPSFFGSNYALRD
TEQLIFARLSFDGSVADVEVNTTAREPRLLLSDPINHRHDAGDVVTFAVVLNHDNRTTSA
DAYDVFLAYAFSDKVVPDNATAVACLVNTTDPLVASAPACLPLASTIASPSTTAATPANN
SSSVNSTGTTTATSTSAMTTTTTTSTSSDGGGDNSLPLTLTAQGFELRLAHLRPFQRVHI
VIEGQVVQDVIPQDKLVNSASLRYDTSPDNETAAYPGKEYALDLDVTTVVVSPVARYEVT
SLSEAETLDNVLTIGEEATVDVLWNLPEGEMPGAVLAVSVPPHTTFLNATIVRIGRSISG
SNVVPYQTYDDNFAVLPSDPTAVLIDLGDLSNTFNNTVNLQDDIHVRVRFFVDNDPANAL
NTFINVETGLAWLGSARWVDSSYPIKIAEPLVSSSVSTPTARPDAQDLLTYTTIVQHDAA
STSPIYRATVVVTTPAEVQLQTGSIDIFSGTVLSSTPTLRVVNASVFEVGFEKMSVLASD
GDEKLTITYDVVVVDEIRANEDIIVTTTNSWWSTPTNFTHPGRFRDGFNDTSPYFGETSQ
HINPAKQNSVTMYLDRSSLEDTIGTQVNVAEELVYRSCITVLEGHTNVSLAIAMHSGLDF
LNASLYSVGADIAESLSFVEGDMFNATTDDSTGGPLVLFAFGELVNTATNVEDDGDAICI
ELAALVANIPENINGIVLPATATLVTDTTQLTSSTETVRVIEPVVTTDPVAITIPGQGAV
EVLSIDSEAVDAGDEVSFEITVRHLPSSTSTTFDVFIEAHLPDYTAVVSVQQGTLPTTIN
TTVPGYVVWHLPKLTLEEESYTTSVTVRVRNDIIPSAADLKCDVTTTAHSSPLADNADAK
AFTSVAESAVLLVKGVNDDLELVSTSIAATAGYDVAVHELATFQYTLVLPEGTVPSITLI
IDQPSDDSLRLDRVELHFGANVACEGVPVLEDAAGAVDHVLQFDNCVNTYDNEDDDADLM
VVTIVTVVQDVVSTLEDRNKAMRFRLQTVHTHGTPGSTRKSSYMETLRLQLPNAAMALDT
VVRNHVLPGDTLQFDATVEQDGNFLAPMFNTSLDIAIPSSLIPVLVLVGVNGAPLTDHPF
TLRDGTNGTATSVLSIPLATILPDDTAAVRVLTEVGSDVEQGLAIAANATLTFDTSEGSP
TYPGRVYAVADDFKTLYVAALVLTQDIVRLNFPGETDVTEVSVYEPLTLRHTVRVRGSYA
LTTTISLPAGGGAGAGAGGGDEEAMIVDTCTTVSVGDNVLITPGATSPGNVVQPTIVHDA
NTHTITLAWGDAVNEATSAVYTQDDDIVYECNARVRNLVWIEAGDVFALGGNAEYAVFTS
SEEHMLTVSDPELVFASFTPSFGATEQSPVTPVQAQEAVTFDFAVNNSLAASVVAATAFD
AQLLLFLPGISNAVVASADPSTQLEYDTDLEAYRLLVDRVGEAEMWTVTLAGTAITQLPV
GVPVEHSAQLSWLSTADPTRELARLHTEEPPTSWTMTVRHPQLDLAVYSTRTVGGWRRVA
GDAQAGSNSSPAPEVTVGGVIWLTLTVDVYAGLHTDLKAVLDVPEGLVLVDHVVSDGHPN
IDLGAGPTVVETGSADGEYEFVFGSPLATAEDTVVLNVYLRVADDKSVNFNGAVKTLRAH
LDYTEFTNQDDQQLDVVVVYPLLQLTGDTSVATADAGDTIVLTQLLRHTDQSEAPAYNIT
VGLMVPGAALLTNVTAVRSMQHTGTNGTVFVEHAFEQYEPTPIIDLGLLNETDAVVVTWT
FVVQQRVQPSSTLAFAAAATYKHGSLTTSRQETAVMAPLDVVVPGIHLQAPGEDDEGRAR
DYGVGDVIHMQVDMDLPEGTLPELVVDLHTTPGTAIVGASLSSLTGHIFASDNEGSVAVM
QGGQESALLGADSNRRRRRASGNDDDDDGAMMSSAANATQRLFDVEADANQRVSAVRVRV
FNVTNNFNNVEDTRDRLVLNVTVAVLDDEAISRNTTVNVTASVSVPWSAASVAVSPTYNI
GEPALNVETFWAFDDSTAVLVFVHTIAHANNSDLNAANLHLTSNVTGTLIVTTSNMTNGT
DWDLLVRGESIVAYHVVVVDSASPQGASVCVQPTVEYNNAGSSSPRAYAQTEHRDCFKLP
EPARSRWQRSMFVTLLAIACGVLFLVLLFLAVSERRRRRRGGKNVGKLPKPAKVMVRPTS
LIRRQGSAAASSPRDALALGNDDEDMDYLVVGDDIDHTYAAPRGPLIALGDGLYAEIDQV
LEAHAGDEEGDYYCTINSAFQDVYEDINSFYANARVRLPDGTYAQMNRYFFNDDGKLRRK
NRDTNDEHIYEEIPEDDPIYEEIKDVLAGTRPRQPMPVIRTKDNRQLGLRRVFRRNSDGS
LVPCFYHDSGLYADAAVVRTENGEYADASDFFKRDGRVFEPLYEEAHILHDTGEYAGARE
AMYDVANPSHDEYLDADAIYDIGEAQGDERMYDMGADVQTDDPIYTMGNDNEEGLDAIYD
MGQETGTDAQYALGNTDNADADGDATYDVGNADAVYGASADDDDTLEPVYDAGQEGLNSA
DPLYDVANRPGTAGGGGGGADGGGTRVRKRDSEPTYDTATFRRRASDQPPPLSGQRLGSA
ADTYDLGDGMALGGGGDGDATYDIGNEEGDALVGGNSHGAGTTTDGDDDAVYTLGDEMDG
FIDDHPLSSVVSSGQSSHRHHYGGRSSAGPMIVAPEPSIRNRGDGDDGNLSVAASSDVYS
IAKSDASRTGGTMGHQHRHHQHHHRHQFHRHQQQQQQHEATYAPYPLQDGADDIYDVSPL
NNAVAPEDVDEEGDYDAQTTRKGSSNMSNAGSDGADDLYAMANKFGYSGGGRDSIDELPL
PPPPPLPLPMMGANTAGNSNTRTRPANTSPQQEKRAQQRYKPVYEALNEAEDDESDADDG
YQRADSTDEDEDEDSVYGHGRSGSERGDSFDADALETRAGPNNTLVVKRRGTRDVEDIYS
VIQKATTPPPPDLPSRSHSCASSVVSIQSLEASPKGQRSVRPPPRLRAPSGQVKQKSTIS
MEWDPHMQ
Download sequence
Identical sequences PTSG_04891T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]