SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04933T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04933T0
Domain Number 1 Region: 6-152
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000181
Family APC10-like 0.032
Further Details:      
 
Weak hits

Sequence:  PTSG_04933T0
Domain Number - Region: 286-325
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.0118
Family C-terminal UvrC-binding domain of UvrB 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_04933T0
Sequence length 991
Comment | PTSG_04933 | Salpingoeca rosetta hypothetical protein (992 aa)
Sequence
MPTRIPFQVVYCSGADDGFSATQLEIPNPAAKGWQSPKFCQWPQVIILKLHTITRVRKIQ
MLSHQYKIATKVDLYVGAVKDGSSNTLKDTTFTKLGHVKLSDNTASDFASRELKSVHVDA
VGQYVKLQFHVNHLNPHNIYNQVGLVALNILGDGAPGGVSIRTQGDVSLARLAEKMLPVT
PPTLQTLTTKSSSMVDVLTSGRINDENYHDESSRGDDGLDPRVLGLINKPATVDETDDMQ
FSLTQDPKTAERILQLKAEKQRAIAEERYADAGRIKGAIDSLIENGRLLGEMETKKLAAV
SREDFEAAQAIKDEIDRIRMQLETQLGLGNLLKPQQQRNSTASQGQLSGQLQTALAMGSL
PTSTPLPSIPSSSASPSNTSVSLQQQQQQQQQQQQQQQPQPPQQQQRASSPPLPALQNRS
QQQHIPEYPQSPQHVQQQQSQQQQSRQQHPTSPPLPAQRTAAARSSSPPLPAVRKRLEEG
GFPGNAAADADDDSLPSRFRDSPTAPSPQPPRPPAKPRSAAARKPRAKAKPAPRKPGGAG
TAAAANARARARGAKRTGGPPRRGRGGATAKLSEDEPPELDDVKRGIASDCISVFGEDTA
RYIMSPQWANKADGLQEVLNGFDEVAEAKGVAHTVPALRCVLEQALRHKVKKVVERGLQV
LAKLCDAVEASSDSAASSALAPIWHLAAPVVLARTGEVATATVDEALALLSRMYSIDHTQ
VSSVALAPLKPTINWRQGKGRVAAVSRLVSDHGLSKAPKGGRGGAPPQLRVADVMSAIAP
ALRHAKVEVRGGAITLVAKCHVVDAAQTEKLWGLREDKDGGLLKAVRQAVAKEKGEALPA
RKQRKKLGAGGGDDDDDDMDEAQKEEVARLKKQLKAVKAAQKQVEEQQQQQQQQQQQQQQ
QQKNKKKSTKAADDDGDDDDGGRDGGDSDGEAAAEEEGEEEEMPAVKGTKAGKNQKGGEG
AKLKGNLKRNRFGWGGKGKKKSVRIANPPVS
Download sequence
Identical sequences F2U915
XP_004994249.1.12839 PTSG_04933T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]