SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04943T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04943T0
Domain Number 1 Region: 199-330
Classification Level Classification E-value
Superfamily C-type lectin-like 1.54e-25
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 2 Region: 38-123
Classification Level Classification E-value
Superfamily Cupredoxins 0.0000416
Family Plastocyanin/azurin-like 0.021
Further Details:      
 
Weak hits

Sequence:  PTSG_04943T0
Domain Number - Region: 111-175
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.000392
Family Phase 1 flagellin 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_04943T0
Sequence length 516
Comment | PTSG_04943 | Salpingoeca rosetta hypothetical protein (517 aa)
Sequence
MQAHTRVLLVLAALCVARGYAAQFAVQWAPSVDDATFDIQISIGDTVVWQNIGTRPESVT
EVRGTDYEGIDGYLPPGDRFRYTFNRPSYAPGDVVVFVSQADPEYMRGTITIVGPSTTTT
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTSSSTSSSSVYTTVVQST
PSTRDVGIVVGPAIPYAERRFCEEGWELRGDKCLRYEARRQPSAYHAQVMCQQNDAYLAT
IQSLDDSIWVRDIVQENEDTSFPFIGLFYDPLTDVFGWSDGEEVSYENWLDSTIIGPATC
VIATDGLRGGSWKTVSCFDRRPYICEKPAATRFLYELDIGVVSVPSFGPEVVVDMMADHP
DACLRACDSNESCLRMAIEVSSMDDSKVQCFGDSNDQSTGSTLDLTSVGTVYTKLQEIDI
PPPIITYSVYAEGSNGFATGLRPVNMFESADILDIFYGLSVEDCQAECTHVQNCVGILRS
RNPSSNYKCRLMARFGELVTTQLMVDTYEKVISEPM
Download sequence
Identical sequences F2U924
XP_004994258.1.12839 PTSG_04943T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]