SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04956T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04956T0
Domain Number 1 Region: 53-162,205-400
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.84e-48
Family beta-glycanases 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_04956T0
Sequence length 535
Comment | PTSG_04956 | Salpingoeca rosetta conserved hypothetical protein (536 aa)
Sequence
MATTTASASALRSTTLSIIILRLKKKKKKKKKKKKKKKKKQDQKLPWITASGEDALLRDE
QGRVRVFHGVNHVQKAFPWYPPILLNTTYIKEMASLGVNVVRLGFMWSGAEPSEGNFNMT
YYQTIDTIVAQLANHNIYTLLDVHQDGFSSKFCLYDGIPLWVANRSVARRPFPWPMQGGC
SSRPWAANELTEACGQAYDDLYHNVRGMRDAFIKFWSFSADYFKNNSNIIGYELINEPFA
GDVYAKPELFLPGVAGRENLALLYDAVAPAIRQRDQRHLIFYEPVTWGMVFNGSVVGSGF
QHVPGGAAHANKSVFSFHYYCWFFDIPGNASTWRRAACDDALGPQVFNAVQRDVGYLGGA
SFLTEFAATTCDPSSGASEECTAVLDLCDEHLVSWIHWPTDTDYPGGVYDWAAYAALGLS
RPYAAAVAGLVQSVSFNNATRTFHMCMQFTALTPSAKTVVRYDKTHMYASGVYIRPSGGL
SIATVSDHDVVLISQQTQGSGCVTLSPPPDNAPDTAVAAATTGTTGTRTGGKGAA
Download sequence
Identical sequences PTSG_04956T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]