SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_05033T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_05033T0
Domain Number 1 Region: 425-756
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.62e-85
Family beta-N-acetylhexosaminidase catalytic domain 0.00000262
Further Details:      
 
Domain Number 2 Region: 338-422
Classification Level Classification E-value
Superfamily beta-N-acetylhexosaminidase-like domain 0.0000000000000344
Family beta-N-acetylhexosaminidase domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_05033T0
Sequence length 798
Comment | PTSG_05033 | Salpingoeca rosetta predicted protein (799 aa)
Sequence
MRREEEDSEGKYRKGGRRRYAYETLGDDDGAASPSFLRGWVKFAVFIPVVIFVFIALNYA
GMHTTMNRPHMQTVAHLHPTTNASNRIASTLPPLPEEMQKGKGKDNNAQQQQQQQEGDNG
GGDGDNASTPADDDDDPAQFEDADGHPTVLSCSSYIKTDKCRIPLEYFEPALPQNRVTPI
PTKKLQSGLDQGVVDILNFKFKCQSMHESSHSTHMLIMHTFERMCLRFASLCSANDASQE
EKTSSQRPKGKRSKKPAKKPTATKSKASAAKAPASMTNNNNNDNNNNNNHASGRARRDIG
DDILGTGPSALGGNTKQAKKTMKVHGVASKKQDMETLVSTSFFTLRQMEVVVRDPDVELD
VGVNEGYALVVPAASDTPITIFSETVWGMIHGMETFFQLIGRRRVDGAPAISGLPVLIED
EPQQPWRGLLLDTSRHFYPLPVIIRLIEGMAMNKLNVLHWHMTDDQSFPIVSQKYPQLAQ
KGAFPAAKTHSYTAAMMGYIAEYAHNRSVVVVPELDVPGHAASWGLGIPDLLSCDGGKSP
LNPTSPKSFEVIRDLIAELAPIFPHPYFHVGGDEFDLNCWKRNPDIAAAMKAQSDPRGEA
MRQQLVDAAFDALKEHGKTPIVWKDLVEGHPTKIPDNAIIQHWKCWGTEVCTLHDTLQKS
DHASVQSTCAYLDFDREWPKFHQQTMLFPDKCGSVDQDVARAVVRGGEAAIWSERISPRN
VFCRTFPRAVAYAERLWSFDVNTVPSQNQTDTFFPRMTNLHKPGLAHAAEAINMERLNQA
HADERFMRVAWKMPHKLE
Download sequence
Identical sequences F2U9B4
PTSG_05033T0 XP_004994348.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]