SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_05128T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_05128T0
Domain Number 1 Region: 2577-2839
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.71e-69
Family Protein kinases, catalytic subunit 0.00000482
Further Details:      
 
Domain Number 2 Region: 3090-3175
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.7e-24
Family Cap-Gly domain 0.00027
Further Details:      
 
Domain Number 3 Region: 1515-1599
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000985
Family Cadherin 0.0048
Further Details:      
 
Domain Number 4 Region: 1261-1301
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000824
Family TNF receptor-like 0.0064
Further Details:      
 
Weak hits

Sequence:  PTSG_05128T0
Domain Number - Region: 580-686
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00209
Family Collagen-binding domain 0.0049
Further Details:      
 
Domain Number - Region: 1223-1265
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0436
Family TNF receptor-like 0.0068
Further Details:      
 
Domain Number - Region: 1071-1147
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0654
Family Collagen-binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_05128T0
Sequence length 3176
Comment | PTSG_05128 | Salpingoeca rosetta ephrin receptor 1 (3177 aa)
Sequence
MESDTDDTNTNKQMDSADYLPLGLTMTGKLNSQEDVDFFVMRLCKAGVGKVDFAVVGNGK
ADIRLLDSSNKVLKEKLAVNGQASLPLDTGGDGQMLYLRLRLSSGSGPVGYTATATIGEC
EEEGECSTEPPTTTSTTEPDTTSPATTTFGTSATGLPRDGFEPNEDIRNAHLLQPHSVTS
GFISSKTDEDFFLLRACAFSSVVVTLDFHGDEYDLDLELINLDNATVGVSDSATSNRESV
AALHRGNRETAFFVRVFGYGGATGPYSLTTNVRSCEARCPQARECTTGWKGPLCQAPDCP
GEPDCNNRGDCVTTANPPICINCMQGWTGLACDIPVTTTSTDPTPATSTSSTTVGTGTLG
TTTAVGGTTTTSTTTTTTRLGPGGVTLPPISIRPGIDINITVLEFDPHEPNNDPANATVL
TVGEQLDAVATREDNDYYVVTGCSSEELTVAMVFSDDRGNLDMQLYGPEGNEIAASISGT
NRENVTVQTGPTAAEATFVVQVFGFRGAQGPYRIQACCASNITGICVASADPFSTATNPF
TRPPVSASAGGGGGGGETAPPTTSPASTATTAAVTYAPDANEPNDSADEATQLDIDVEFA
TQGTISNAQDNDYFEITACPDEDLLVVLQFSHAQGNLDMTMANAAGLTAGSESTTDNERI
SVSVTGTGAENQIFYVRVYGYEGATGTYAIQACCSSGLVGLCTTPTTTSTSSTTTSTTSS
TITNNGNSFSTTTTTTVATTTTAAVTYTADANEPNDISGTPIQTGSQNEGTISTPGDNDM
FVVTGCQGEDLVIVLGFSHAQGDLDLEVVDAQGTVVTSDSITDNERVTVTAGFGENATFT
VNVQGYEAATGPYILQACCASSLSGLCALPSTTSPFVDSTSTSTSSAGVTQGTGETTFRR
TSSTSVTSTSSISRSRMTTEPSTGVEESTSYSPYTTTSTTATTTTMPLLPVEDEPNSLAS
AATFLPPDVLMQGSIGSGGDRDFFEVPVCDDSSLSVTLTCTGTCRAVRFNFFNSLSEIIA
DEVVTSASATITKSGITGSKVYVSVRPQFSIRVSYTLIARVDGCGVPETDGNEPNDGAAI
STALSPGHVSTGVISDTDDVDFFSMTACSSGVLSFTISFSHAEGDLDLRLFDSRGSVVDS
SETALNREVVYARGSPVALPFYARVQGSHGATGAYTIVAHDGCCTTQADCGASLFCSSGL
CEFCGACPSGQFRVGCDDSHAGQCRDCAPCPAGSIRVDCGRSSPGTCQACPPGHYTVSGR
NECVSARNCVAGQFVLREPSPSTDRVCASCPTGTFSTAQNAQLCQSPRACVPPKVETFAP
TPTSDRQCDYCELGVAFYHRPSGVCKPVSSCPAGAHVATPPTIASDVICETESYVCAYGQ
RSVGANSMCNCTAFGDACTVCNRHDSLEQRSDAVLLMLYAQPVDYTPITSLTITDLSVDA
VSTCATYCRQYRPQGCVGFTHVQTSTTTRTCTLVSSYRSVPSDAPTARFYTLPQCQSCEP
GFAVDNLGCTRITSSPEFPNNQPSPLIPINVEPGTAIANLTATSDAPGEQAVLTYEFAEP
NSAHEAFAIDSTTGVVTVTRPLLSPVTVRLTVIATDSRPQCNQYVGTQLNKQLGPCSSQP
FTLEVRVAALLGCPSDINEYVSPIDTNATVSWASRPRFPASTSFLTLALYRDGMPVSPTA
TTFTVPVGQTVFAYKSVEALSIGDQLECSFTVSIRQGFFMEAEDVDLRETESSHLAFVLS
SRGLADTARPAPFVSDLASPFFIGVRSASGRPLIISPPEGVEAEISVALSWCTTNAPIPQ
NPRPRHTVAAPVNVTLAGFTSTEVAQPPVFTDQGSWILTTSTRSCINIEAKSTKFSKALE
FVTLEVGVVPPPQARRRRSLPEDMVFIPSFPSLLVVDLQDEGGNKTDANLDGAVTFEDLV
APQFLACPPAESERTFAVVGDATEATVTLPAMSAFDTIDKSPVIEYPFQSANLSAIDSPH
SVTVYAVDSSNNRRACTFDVLVTVDEHELKRTETVQTWRFPIQRRVADVVDLVYFTHTIP
IYSSDIMTFDADLTTLTKLQFSLESPSTNVPFVVRFRPQPVTARIVVDARWLANGTGAAI
LFGKQENALAFVRVEDFRYDDEPSTVAPQTKDFALLEQDVAASEEDGLVGVFGKTDELPR
PFSFTRISVVLRFLGAPDARGEATWTMVNGSYIGVEFEYNLGHSTVTTTNGSTVVETPRS
QDVRGFLALRDQSPPLFSFCPDDISVHTAPGRGSAEVSWPTPTSTDNREVVSTTGSVPSG
TTFGVVEPGMPHHVVTYVSRDLFDNTATCEFEVRVVDNEPPVTSAPRMVYKTLPPNAAVV
SVVRSEWEPVNVTDNSEEQGTWAAPTLVWDNATATYGLGVHVIGMRYEDAFGNNVTTTAV
ITVNDVTPPSVVCPSDIERLAAVGESSSVAKWELVAPTDNNGLAVHVSMNRTSGSAFAIG
HHVVLVEATDAAGLTATCTFTVTVVGQSTQAPTPPPGGTTIKQPQASQSSASTGIIAGAA
AAGALLLILIIAVLIFVNRMRAKSRAPQDWDDIFQLMAHLQASEDGFRYPRELSRPALKL
LGDLGKGAFGVVHKGMLKEHANIPGYLVAVKSLHEDASLADRQELLEEAAVTAQFTSPHV
VELVGVVTVGNPVYVVVEFMEHGALKSYLEKNDVPEEKRLLWAGDCCEGLAHIHGKGFIH
RDVAARNVLLSSEMRCKISDFGLAREMEEDDTYYKSRGGQLPVRWTAIEALEERKFNEKT
DVWSCGILLHEMWTRAELPYKGWSNQKVWVEVAAGYRLPKPDGCRDDVYEHMLACWSESQ
ADRPTFAALAEFFRRLHPDPSASNEHDGGYLELHPTGSLEKTASPTDSGNLYDMGSNNDV
AASGADLYDMGDGGDAATDASALNTADASNLYDMGAANDADTQDTTAATGADLYDMGDGG
EDGAAFGANDPDNLYDMGSDEPSAMMPSGRQELSGADLYDMGDGVDAGHASSVYDMGGND
NLYDMGENDESGGDASNLYDMGGDEPSASLPAARFGARNSTGNAAGDLYDMGDDDTTGTA
RPPLNTANSETFGFGDDLYHNTDNEEQHINAPAGSRQRGDVTEADVGKRVHVQGYTCNGV
LRFVGPHHVTSAMRCGVELDEPLGKNDGSIRGHRYFKCKPAHGVLATMHKVMVLDE
Download sequence
Identical sequences PTSG_05128T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]